Recombinant Full Length Human Leukotriene B4 Receptor 2(Ltb4R2) Protein, His-Tagged
Cat.No. : | RFL19262HF |
Product Overview : | Recombinant Full Length Human Leukotriene B4 receptor 2(LTB4R2) Protein (Q9NPC1) (1-389aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-389) |
Form : | Lyophilized powder |
AA Sequence : | MAPSHRASQVGFCPTPERPLWRLPPTCRPRRMSVCYRPPGNETLLSWKTSRATGTAFLLL AALLGLPGNGFVVWSLAGWRPARGRPLAATLVLHLALADGAVLLLTPLFVAFLTRQAWPL GQAGCKAVYYVCALSMYASVLLTGLLSLQRCLAVTRPFLAPRLRSPALARRLLLAVWLAA LLLAVPAAVYRHLWRDRVCQLCHPSPVHAAAHLSLETLTAFVLPFGLMLGCYSVTLARLR GARWGSGRHGARVGRLVSAIVLAFGLLWAPYHAVNLLQAVAALAPPEGALAKLGGAGQAA RAGTTALAFFSSSVNPVLYVFTAGDLLPRAGPRFLTRLFEGSGEARGGGRSREGTMELRT TPQLKVVGQGRGNGDPGGGMEKDGPEWDL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LTB4R2 |
Synonyms | LTB4R2; BLT2R; BLTR2; Leukotriene B4 receptor 2; LTB4-R 2; LTB4-R2; LTB4 receptor JULF2; Leukotriene B4 receptor BLT2; Seven transmembrane receptor BLTR2 |
UniProt ID | Q9NPC1 |
◆ Recombinant Proteins | ||
LTB4R2-3155R | Recombinant Rat LTB4R2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LTB4R2-5236M | Recombinant Mouse LTB4R2 Protein, His (Fc)-Avi-tagged | +Inquiry |
LTB4R2-3499R | Recombinant Rat LTB4R2 Protein | +Inquiry |
RFL35227MF | Recombinant Full Length Mouse Leukotriene B4 Receptor 2(Ltb4R2) Protein, His-Tagged | +Inquiry |
RFL3613RF | Recombinant Full Length Rat Leukotriene B4 Receptor 2(Ltb4R2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTB4R2-9166HCL | Recombinant Human LTB4R2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LTB4R2 Products
Required fields are marked with *
My Review for All LTB4R2 Products
Required fields are marked with *