Recombinant Full Length Human LGALS9 Protein, C-Flag-tagged
Cat.No. : | LGALS9-1547HFL |
Product Overview : | Recombinant Full Length Human LGALS9 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. It is overexpressed in Hodgkin's disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency. Multiple alternatively spliced transcript variants have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.3 kDa |
AA Sequence : | MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGG YVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSV QLSYISFQNPRTVPVQPAFSTVPFSQPVCFPPRPRGRRQKPPGVWPANPAPITQTVIHTVQSAPGQMFST PAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRN TQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQL THVQTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | LGALS9 galectin 9 [ Homo sapiens (human) ] |
Official Symbol | LGALS9 |
Synonyms | HUAT; LGALS9A |
Gene ID | 3965 |
mRNA Refseq | NM_009587.3 |
Protein Refseq | NP_033665.1 |
MIM | 601879 |
UniProt ID | O00182 |
◆ Recombinant Proteins | ||
LGALS9-471HAF647 | Recombinant Human LGALS9 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
Lgals9-435M | Recombinant Mouse Lgals9 Protein(Met1-Thr322), GST-tagged | +Inquiry |
LGALS9-195H | Active Recombinant Human LGALS9 Protein (Ala2-Thr355), N-His tagged, Animal-free, Carrier-free | +Inquiry |
LGALS9-3224M | Recombinant Mouse LGALS9 protein, His-tagged | +Inquiry |
LGALS9-471H | Recombinant Human LGALS9 Protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS9-4761HCL | Recombinant Human LGALS9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS9 Products
Required fields are marked with *
My Review for All LGALS9 Products
Required fields are marked with *
0
Inquiry Basket