Recombinant Full Length Human LINC01465 Protein, GST-tagged

• Cat.No.: LINC01465-1760HF
• Product Overview: Human LINC01465 full-length ORF (BAC05309.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 131 amino acids
• Description: LINC01465 (Long Intergenic Non-Protein Coding RNA 1465) is an RNA Gene, and is affiliated with the lncRNA class.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 39.8 kDa
• AA Sequence: MGGKSAVRHQLVLDCPREAASSAPALRPLGAAATSRAAPLAPLPAPSPRWGLGCGRVRYPGPHPRRAVEPAAGPLSAPIIAGGHPAEAAAGSAKQQPRHSREVPRPPVPQHPSGNSRSALQEAKTEQTKTP
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LINC01465 long intergenic non-protein coding RNA 1465 [ Homo sapiens (human) ]
• Official Symbol: LINC01465
• Synonyms: C12ORF61; chromosome 12 open reading frame 61; putative uncharacterized protein C12orf61; FLJ25590; C12orf61
• Gene ID: 283416
• mRNA Refseq: NM_175895
• Protein Refseq: NP_787091
• UniProt ID: Q8N7H1