Recombinant Full Length Human LINC01600 Protein, GST-tagged
Cat.No. : | LINC01600-2699HF |
Product Overview : | Human LINC01600 full-length ORF (BAB71197.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 127 amino acids |
Description : | LINC01600 (Long Intergenic Non-Protein Coding RNA 1600) is an RNA Gene, and is affiliated with the non-coding RNA class. |
Molecular Mass : | 40.37 kDa |
AA Sequence : | MFYPLDLFRNIPWKQGKCFASLSPEGERAFDGMEPLCQPGARPALRGLQHASDCYRLLSPPGSGLVGTNPSVPAPSPHCGCCRAWSISSFTFTGPTPFKINSDQATPCHLRSPETISRQREISNEAF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LINC01600 long intergenic non-protein coding RNA 1600 [ Homo sapiens (human) ] |
Official Symbol | LINC01600 |
Synonyms | LINC01600; long intergenic non-protein coding RNA 1600; bA145H9.2; RP11-145H9.2 |
Gene ID | 154386 |
mRNA Refseq | NM_152554 |
Protein Refseq | NP_689767 |
UniProt ID | Q96MT4 |
◆ Recombinant Proteins | ||
LINC01600-2699HF | Recombinant Full Length Human LINC01600 Protein, GST-tagged | +Inquiry |
LINC01600-0113H | Recombinant Human LINC01600 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LINC01600 Products
Required fields are marked with *
My Review for All LINC01600 Products
Required fields are marked with *