Recombinant Human LINC01600 Protein, GST-Tagged

• Cat.No.: LINC01600-0113H
• Product Overview: Human LINC01600 full-length ORF (BAB71197.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: LINC01600 (Long Intergenic Non-Protein Coding RNA 1600) is an RNA Gene, and is affiliated with the non-coding RNA class.
• Molecular Mass: 40.37 kDa
• AA Sequence: MFYPLDLFRNIPWKQGKCFASLSPEGERAFDGMEPLCQPGARPALRGLQHASDCYRLLSPPGSGLVGTNPSVPAPSPHCGCCRAWSISSFTFTGPTPFKINSDQATPCHLRSPETISRQREISNEAF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LINC01600 long intergenic non-protein coding RNA 1600 [ Homo sapiens (human) ]
• Official Symbol: LINC01600
• Synonyms: LINC01600; long intergenic non-protein coding RNA 1600; bA145H9.2; RP11-145H9.2
• Gene ID: 154386
• mRNA Refseq: NM_152554
• Protein Refseq: NP_689767
• UniProt ID: Q96MT4