Recombinant Human LINC01600 Protein, GST-Tagged

Cat.No. : LINC01600-0113H
Product Overview : Human LINC01600 full-length ORF (BAB71197.1, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LINC01600 (Long Intergenic Non-Protein Coding RNA 1600) is an RNA Gene, and is affiliated with the non-coding RNA class.
Molecular Mass : 40.37 kDa
AA Sequence : MFYPLDLFRNIPWKQGKCFASLSPEGERAFDGMEPLCQPGARPALRGLQHASDCYRLLSPPGSGLVGTNPSVPAPSPHCGCCRAWSISSFTFTGPTPFKINSDQATPCHLRSPETISRQREISNEAF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LINC01600 long intergenic non-protein coding RNA 1600 [ Homo sapiens (human) ]
Official Symbol LINC01600
Synonyms LINC01600; long intergenic non-protein coding RNA 1600; bA145H9.2; RP11-145H9.2
Gene ID 154386
mRNA Refseq NM_152554
Protein Refseq NP_689767
UniProt ID Q96MT4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LINC01600 Products

Required fields are marked with *

My Review for All LINC01600 Products

Required fields are marked with *

0
cart-icon
0
compare icon