Recombinant Full Length Human LOC399886 Protein, GST-tagged
| Cat.No. : | LOC399886-4910HF |
| Product Overview : | Human FLJ41423 full-length ORF ( ADR83482.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 167 amino acids |
| Description : | LOC399886 (Uncharacterized LOC399886) is an RNA Gene, and is affiliated with the ncRNA class. |
| Molecular Mass : | 18.4 kDa |
| AA Sequence : | MAALSSRCPRSAAGPAYLQEAARSAHWASPPLVPLRTFQSSLFSSGSFHSREEEEEGVSLLRTALVGQGPVPLFLGSLFCAGCRQGPSVWSCGEPVPRRIWVTASVTPSPRQALHPCSDSLDILKALHLLPAAFSPFIWVQVFAEPSNKESRGENDGGEERESANIY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LOC399886 uncharacterized LOC399886 [ Homo sapiens (human) ] |
| Official Symbol | LOC399886 |
| Synonyms | LOC399886; uncharacterized LOC399886; FLJ41423 |
| Gene ID | 399886 |
| ◆ Recombinant Proteins | ||
| LOC399886-4910HF | Recombinant Full Length Human LOC399886 Protein, GST-tagged | +Inquiry |
| LOC399886-4337H | Recombinant Human LOC399886 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LOC399886 Products
Required fields are marked with *
My Review for All LOC399886 Products
Required fields are marked with *
