Recombinant Full Length Human Low Affinity Immunoglobulin Epsilon Fc Receptor(Fcer2) Protein, His-Tagged
Cat.No. : | RFL15321HF |
Product Overview : | Recombinant Full Length Human Low affinity immunoglobulin epsilon Fc receptor(FCER2) Protein (P06734) (1-321aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-321) |
Form : | Lyophilized powder |
AA Sequence : | MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FCER2 |
Synonyms | Blast 2; BLAST-2; Blast2; C type lectin domain family 4 member J; C-type lectin domain family 4; C-type lectin domain family 4 member J; C-type lectin domain family 4; member J; CD 23; CD 23A; CD23; CD23 antigen; CD23A; CLEC 4J; CLEC4J; Fc epsilon recepto |
UniProt ID | P06734 |
◆ Recombinant Proteins | ||
FCER2-539H | Recombinant Human FCER2 Protein | +Inquiry |
FCER2-5164H | Active Recombinant Human FCER2 Protein, His-Avi-tagged, Biotinylated | +Inquiry |
FCER2-343R | Recombinant Rat FCER2 protein(Glu50-Pro331), hFc-tagged | +Inquiry |
FCER2-27296TH | Recombinant Human FCER2 protein(48-248aa), GST-tagged | +Inquiry |
FCER2-343RAF647 | Recombinant Rat Fcer2 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCER2-1023RCL | Recombinant Rat FCER2 cell lysate | +Inquiry |
FCER2-1814HCL | Recombinant Human FCER2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER2 Products
Required fields are marked with *
My Review for All FCER2 Products
Required fields are marked with *