Recombinant Full Length Human Low Affinity Immunoglobulin Gamma Fc Region Receptor Iii-A(Fcgr3A) Protein, His-Tagged
Cat.No. : | RFL16480HF |
Product Overview : | Recombinant Full Length Human Low affinity immunoglobulin gamma Fc region receptor III-A(FCGR3A) Protein (P08637) (17-254aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (17-254) |
Form : | Lyophilized powder |
AA Sequence : | GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDWKDHKFKWRKDPQDK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | FCGR3A |
Synonyms | FCGR3A; CD16A; FCG3; FCGR3; IGFR3; Low affinity immunoglobulin gamma Fc region receptor III-A; CD16a antigen; Fc-gamma RIII-alpha; Fc-gamma RIII; Fc-gamma RIIIa; FcRIII; FcRIIIa; FcR-10; IgG Fc receptor III-2; CD antigen CD16a |
UniProt ID | P08637 |
◆ Recombinant Proteins | ||
FCGR3A-309H | Active Recombinant Human FCGR3A protein, His-tagged | +Inquiry |
FCGR3A-22H | Recombinant Human FCGR3A Protein, Gly17-Gln208, C-6×His tagged | +Inquiry |
FCGR3A-151H | Recombinant Human FCGR3A Protein, DYKDDDDK-tagged | +Inquiry |
FCGR3A-5743H | Recombinant Human FCGR3A protein, His&Myc-tagged | +Inquiry |
FCGR3A-214H | Active Recombinant Human FCGR3A protein(F176), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGR3A-001HCL | Recombinant Human FCGR3A cell lysate | +Inquiry |
FCGR3A-1999HCL | Recombinant Human FCGR3A cell lysate | +Inquiry |
FCGR3A-1969RCL | Recombinant Rat FCGR3A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCGR3A Products
Required fields are marked with *
My Review for All FCGR3A Products
Required fields are marked with *