Recombinant Full Length Human LRG1 Protein, GST-tagged
| Cat.No. : | LRG1-6007HF |
| Product Overview : | Human LRG1 full-length ORF ( AAH34389, 37 a.a. - 347 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 37-347 amino acids |
| Description : | The leucine-rich repeat (LRR) family of proteins, including LRG1, have been shown to be involved in protein-protein interaction, signal transduction, and cell adhesion and development. LRG1 is expressed during granulocyte differentiation (ODonnell et al., 2002 [PubMed 12223515]).[supplied by OMIM |
| Molecular Mass : | 59.95 kDa |
| AA Sequence : | TLSPKDCQVFRPDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQRDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LRG1 leucine-rich alpha-2-glycoprotein 1 [ Homo sapiens ] |
| Official Symbol | LRG1 |
| Synonyms | LRG1; leucine-rich alpha-2-glycoprotein 1; leucine-rich alpha-2-glycoprotein; leucine rich alpha 2 glycoprotein; LRG; 1300008B03Rik; 2310031E04Rik; HMFT1766; FLJ45787; |
| Gene ID | 116844 |
| mRNA Refseq | NM_052972 |
| Protein Refseq | NP_443204 |
| MIM | 611289 |
| UniProt ID | P02750 |
| ◆ Recombinant Proteins | ||
| LRG1-141H | Recombinant Human LRG1, His tagged | +Inquiry |
| LRG1-297HFL | Recombinant Full Length Human LRG1 Protein, C-Flag-tagged | +Inquiry |
| Lrg1-1987R | Recombinant Rat Lrg1 protein, His & GST-tagged | +Inquiry |
| Lrg1-1986M | Recombinant Mouse Lrg1 protein, His & GST-tagged | +Inquiry |
| Lrg1-7854M | Recombinant Mouse Lrg1 protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| LRG1-240H | Native Human Leucine-rich Alpha 2 Glycoprotein-1 (LRG1) | +Inquiry |
| LRG1-3684H | Native Human LRG1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LRG1-230HKCL | Human LRG1 Knockdown Cell Lysate | +Inquiry |
| LRG1-791HCL | Recombinant Human LRG1 cell lysate | +Inquiry |
| LRG1-755HCL | Recombinant Human LRG1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRG1 Products
Required fields are marked with *
My Review for All LRG1 Products
Required fields are marked with *
