Recombinant Full Length Human LRP1 Protein
| Cat.No. : | LRP1-6010HF |
| Product Overview : | Human LRP1 full-length ORF (AAH45107.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 372 amino acids |
| Description : | This gene encodes a member of the low-density lipoprotein receptor family of proteins. The encoded preproprotein is proteolytically processed by furin to generate 515 kDa and 85 kDa subunits that form the mature receptor (PMID: 8546712). This receptor is involved in several cellular processes, including intracellular signaling, lipid homeostasis, and clearance of apoptotic cells. In addition, the encoded protein is necessary for the alpha 2-macroglobulin-mediated clearance of secreted amyloid precursor protein and beta-amyloid, the main component of amyloid plaques found in Alzheimer patients. Expression of this gene decreases with age and has been found to be lower than controls in brain tissue from Alzheimer's disease patients. [provided by RefSeq, Oct 2015] |
| Form : | Liquid |
| Molecular Mass : | 31.6 kDa |
| AA Sequence : | MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEAPEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGCQHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYLLQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHLCVFSKSQQEMG |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | LRP1 low density lipoprotein receptor-related protein 1 [ Homo sapiens ] |
| Official Symbol | LRP1 |
| Synonyms | LRP1; low density lipoprotein receptor-related protein 1; A2MR, alpha 2 macroglobulin receptor , APR; prolow-density lipoprotein receptor-related protein 1; CD91; LRP; LRP-1; type V tgf-beta receptor; apolipoprotein E receptor; alpha-2-macroglobulin receptor; TbetaR-V/LRP-1/IGFBP-3 receptor; APR; A2MR; APOER; TGFBR5; IGFBP3R; FLJ16451; MGC88725; |
| Gene ID | 4035 |
| mRNA Refseq | NM_002332 |
| Protein Refseq | NP_002323 |
| MIM | 107770 |
| UniProt ID | Q07954 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRP1 Products
Required fields are marked with *
My Review for All LRP1 Products
Required fields are marked with *
