Recombinant Full Length Human LRRC18 Protein, GST-tagged
Cat.No. : | LRRC18-5946HF |
Product Overview : | Human LRRC18 full-length ORF ( NP_001006940.2, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 261 amino acids |
Description : | LRRC18 (Leucine Rich Repeat Containing 18) is a Protein Coding gene. Diseases associated with LRRC18 include Usher Syndrome, Type Ik and Deafness, Autosomal Recessive 33. An important paralog of this gene is PIDD1. |
Molecular Mass : | 56.1 kDa |
AA Sequence : | MVKGEKGPKGKKITLKVARNCIKITFDGKKRLDLSKMGITTFPKCILRLSDMDELDLSRNLIRKIPDSISKFQNLRWLDLHSNYIDKLPESIGQMTSLLYLNVSNNRLTSNGLPVELKQLKNIRAVNLGLNHLDSVSTTLGALKELHEVGLHDNLLNNIPVSISKLPKLKKLNIKRNPFPKPGESEIFIDSIRRLENLYVVEEKDLCAACLRKCQNARDNLNRIKNMATTTPRKTIFPNLISPNSMAKDSWEDWRIRLTSS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRRC18 leucine rich repeat containing 18 [ Homo sapiens ] |
Official Symbol | LRRC18 |
Synonyms | UNQ933; UNQ9338; VKGE9338; LRRC18; leucine rich repeat containing 18 |
Gene ID | 474354 |
mRNA Refseq | NM_001006939 |
Protein Refseq | NP_001006940 |
MIM | 619002 |
UniProt ID | Q8N456 |
◆ Recombinant Proteins | ||
LRRC18-5174M | Recombinant Mouse LRRC18 Protein, His (Fc)-Avi-tagged | +Inquiry |
LRRC18-6526H | Recombinant Human LRRC18 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LRRC18-4682H | Recombinant Human LRRC18 Protein, GST-tagged | +Inquiry |
LRRC18-5946HF | Recombinant Full Length Human LRRC18 Protein, GST-tagged | +Inquiry |
LRRC18-3116R | Recombinant Rat LRRC18 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRC18-4646HCL | Recombinant Human LRRC18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC18 Products
Required fields are marked with *
My Review for All LRRC18 Products
Required fields are marked with *