Recombinant Full Length Human LRRC57 Protein, GST-tagged
| Cat.No. : | LRRC57-6063HF |
| Product Overview : | Human LRRC57 full-length ORF ( NP_694992.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 239 amino acids |
| Description : | LRRC57 (Leucine Rich Repeat Containing 57) is a Protein Coding gene. An important paralog of this gene is PIDD1. |
| Molecular Mass : | 53.1 kDa |
| AA Sequence : | MGNSALRAHVETAQKTGVFQLKDRGLTEFPADLQKLTSNLRTIDLSNNKIESLPPLLIGKFTLLKSLSLNNNKLTVLPDEICNLKKLETLSLNNNHLRELPSTFGQLSALKTLSLSGNQLGALPPQLCSLRHLDVMDLSKNQIRSIPDSVGELQVIELNLNQNQISQISVKISCCPRLKILRLEENCLELSMLPQSILSDSQICLLAVEGNLFEIKKLRELEGYDKYMERFTATKKNFA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LRRC57 leucine rich repeat containing 57 [ Homo sapiens ] |
| Official Symbol | LRRC57 |
| Synonyms | LRRC57; leucine rich repeat containing 57; leucine-rich repeat-containing protein 57; FLJ36812; DKFZp686H1865; |
| Gene ID | 255252 |
| mRNA Refseq | NM_153260 |
| Protein Refseq | NP_694992 |
| UniProt ID | Q8N9N7 |
| ◆ Recombinant Proteins | ||
| LRRC57-2383R | Recombinant Rhesus Macaque LRRC57 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LRRC57-2563R | Recombinant Rhesus monkey LRRC57 Protein, His-tagged | +Inquiry |
| LRRC57-977H | Recombinant Human LRRC57 Protein, MYC/DDK-tagged | +Inquiry |
| LRRC57-2452H | Recombinant Human LRRC57 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LRRC57-4452C | Recombinant Chicken LRRC57 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LRRC57-1033HCL | Recombinant Human LRRC57 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LRRC57 Products
Required fields are marked with *
My Review for All LRRC57 Products
Required fields are marked with *
