Recombinant Full Length Human LRRFIP1 Protein, GST-tagged
Cat.No. : | LRRFIP1-6074HF |
Product Overview : | Human LRRFIP1 full-length ORF ( AAH10662, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 105 amino acids |
Description : | LRRFIP1 (LRR Binding FLII Interacting Protein 1) is a Protein Coding gene. Diseases associated with LRRFIP1 include Gingival Recession. Among its related pathways are Innate Immune System and FGFR1 mutant receptor activation. GO annotations related to this gene include protein homodimerization activity and double-stranded RNA binding. An important paralog of this gene is LRRFIP2. |
Molecular Mass : | 37.29 kDa |
AA Sequence : | MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 [ Homo sapiens ] |
Official Symbol | LRRFIP1 |
Synonyms | LRRFIP1; leucine rich repeat (in FLII) interacting protein 1; leucine-rich repeat flightless-interacting protein 1; FLAP 1; FLIIAP1; GC binding factor 2; GCF 2; HUFI 1; TRIP; GC-binding factor 2; NEDD8-conjugating enzyme; TAR RNA-interacting protein; LRR FLII-interacting protein 1; GCF2; FLAP1; GCF-2; FLAP-1; HUFI-1; MGC10947; MGC119738; MGC119739; |
Gene ID | 9208 |
mRNA Refseq | NM_001137550 |
Protein Refseq | NP_001131022 |
MIM | 603256 |
UniProt ID | Q32MZ4 |
◆ Recombinant Proteins | ||
LRRFIP1-5295H | Recombinant Human LRRFIP1 Protein (Asp615-Ser735), N-His tagged | +Inquiry |
LRRFIP1-6074HF | Recombinant Full Length Human LRRFIP1 Protein, GST-tagged | +Inquiry |
LRRFIP1-634H | Recombinant Human LRRFIP1 Protein (1-314 aa), His-tagged | +Inquiry |
LRRFIP1-4985H | Recombinant Human LRRFIP1 Protein, Flag tagged | +Inquiry |
LRRFIP1-4364H | Recombinant Human LRRFIP1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LRRFIP1-4620HCL | Recombinant Human LRRFIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LRRFIP1 Products
Required fields are marked with *
My Review for All LRRFIP1 Products
Required fields are marked with *
0
Inquiry Basket