Recombinant Full Length Human LRRFIP1 Protein, GST-tagged

Cat.No. : LRRFIP1-6074HF
Product Overview : Human LRRFIP1 full-length ORF ( AAH10662, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 105 amino acids
Description : LRRFIP1 (LRR Binding FLII Interacting Protein 1) is a Protein Coding gene. Diseases associated with LRRFIP1 include Gingival Recession. Among its related pathways are Innate Immune System and FGFR1 mutant receptor activation. GO annotations related to this gene include protein homodimerization activity and double-stranded RNA binding. An important paralog of this gene is LRRFIP2.
Molecular Mass : 37.29 kDa
AA Sequence : MHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVSRYKSAAENAEKIEDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LRRFIP1 leucine rich repeat (in FLII) interacting protein 1 [ Homo sapiens ]
Official Symbol LRRFIP1
Synonyms LRRFIP1; leucine rich repeat (in FLII) interacting protein 1; leucine-rich repeat flightless-interacting protein 1; FLAP 1; FLIIAP1; GC binding factor 2; GCF 2; HUFI 1; TRIP; GC-binding factor 2; NEDD8-conjugating enzyme; TAR RNA-interacting protein; LRR FLII-interacting protein 1; GCF2; FLAP1; GCF-2; FLAP-1; HUFI-1; MGC10947; MGC119738; MGC119739;
Gene ID 9208
mRNA Refseq NM_001137550
Protein Refseq NP_001131022
MIM 603256
UniProt ID Q32MZ4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LRRFIP1 Products

Required fields are marked with *

My Review for All LRRFIP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon