Recombinant Full Length Human LTA4H Protein, C-Flag-tagged
Cat.No. : | LTA4H-1096HFL |
Product Overview : | Recombinant Full Length Human LTA4H Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is an enzyme that contains both hydrolase and aminopeptidase activities. The hydrolase activity is used in the final step of the biosynthesis of leukotriene B4, a proinflammatory mediator. The aminopeptidase activity has been shown to degrade proline-glycine-proline (PGP), a neutrophil chemoattractant and biomarker for chronic obstructive pulmonary disease (COPD). Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 69.1 kDa |
AA Sequence : | MPEIVDTCSLASPASVCRTKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQ EVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIH CRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRKIYKFIQKVPIPCYLIALVVGAL ESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVT PTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKFRHFNALGGWGEL QNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSI TTDDWKDFLYSYFKDKVDVLNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLNSFNAT DLKDLSSHQLNEFLAQTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMAT EQGRMKFTRPLFKDLAAFDKSHDQAVRTYQEHKASMHPVTAMLVGKDLKVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protease |
Protein Pathways : | Arachidonic acid metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | LTA4H leukotriene A4 hydrolase [ Homo sapiens (human) ] |
Official Symbol | LTA4H |
Synonyms | leukotriene A4 hydrolase |
Gene ID | 4048 |
mRNA Refseq | NM_000895.3 |
Protein Refseq | NP_000886.1 |
MIM | 151570 |
UniProt ID | P09960 |
◆ Recombinant Proteins | ||
LTA4H-2406H | Recombinant Human LTA4H Protein, His-tagged | +Inquiry |
LTA4H-1381C | Recombinant Chicken LTA4H | +Inquiry |
LTA4H-306H | Recombinant Human LTA4H Protein, His-tagged | +Inquiry |
LTA4H-798H | Recombinant Human LTA4H Protein | +Inquiry |
LTA4H-84H | Recombinant Human LTA4H protein, T7/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTA4H-653MCL | Recombinant Mouse LTA4H cell lysate | +Inquiry |
LTA4H-731HCL | Recombinant Human LTA4H cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LTA4H Products
Required fields are marked with *
My Review for All LTA4H Products
Required fields are marked with *
0
Inquiry Basket