Recombinant Full Length Human LUC7L Protein, C-Flag-tagged
Cat.No. : | LUC7L-610HFL |
Product Overview : | Recombinant Full Length Human LUC7L Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 43.5 kDa |
AA Sequence : | MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRAD YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKA EQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF GGKLHLGFIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRS RSTSRERRKLSRSRSRDRHRRHRSRSRSHSRGHRRASRDRSAKYKFSRERASREESWESGRSERGPPDWR LESSNGKMASRRSEEKEAGEITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | LUC7L LUC7 like [ Homo sapiens (human) ] |
Official Symbol | LUC7L |
Synonyms | Luc7; SR+89; LUC7B1; hLuc7B1 |
Gene ID | 55692 |
mRNA Refseq | NM_201412.3 |
Protein Refseq | NP_958815.1 |
MIM | 607782 |
UniProt ID | Q9NQ29 |
◆ Recombinant Proteins | ||
LUC7L-2938H | Recombinant Human LUC7-like (S. cerevisiae), His-tagged | +Inquiry |
Luc7l-3865M | Recombinant Mouse Luc7l Protein, Myc/DDK-tagged | +Inquiry |
LUC7L-1328H | Recombinant Human LUC7L Protein, His (Fc)-Avi-tagged | +Inquiry |
LUC7L-3559H | Recombinant Human LUC7L protein, His-tagged | +Inquiry |
LUC7L-438H | Recombinant Human LUC7L Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
LUC7L-4607HCL | Recombinant Human LUC7L 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LUC7L Products
Required fields are marked with *
My Review for All LUC7L Products
Required fields are marked with *
0
Inquiry Basket