Recombinant Full Length Human LXN Protein, GST-tagged
Cat.No. : | LXN-6224HF |
Product Overview : | Human LXN full-length ORF ( NP_064554.2, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 222 amino acids |
Description : | This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. [provided by RefSeq |
Molecular Mass : | 52.2 kDa |
AA Sequence : | MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LXN latexin [ Homo sapiens ] |
Official Symbol | LXN |
Synonyms | LXN; latexin; MUM; tissue carboxypeptidase inhibitor; endogenous carboxypeptidase inhibitor; ECI; TCI; |
Gene ID | 56925 |
mRNA Refseq | NM_020169 |
Protein Refseq | NP_064554 |
MIM | 609305 |
UniProt ID | Q9BS40 |
◆ Recombinant Proteins | ||
LXN-29855TH | Recombinant Human LXN, T7 -tagged | +Inquiry |
LXN-795H | Recombinant Human LXN, Fc tagged | +Inquiry |
LXN-4881C | Recombinant Chicken LXN | +Inquiry |
LXN-1218H | Recombinant Human LXN Protein, MYC/DDK-tagged | +Inquiry |
LXN-29856TH | Recombinant Human LXN | +Inquiry |
◆ Cell & Tissue Lysates | ||
LXN-2898HCL | Recombinant Human LXN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LXN Products
Required fields are marked with *
My Review for All LXN Products
Required fields are marked with *
0
Inquiry Basket