Recombinant Full Length Human LXN Protein, GST-tagged

Cat.No. : LXN-6224HF
Product Overview : Human LXN full-length ORF ( NP_064554.2, 1 a.a. - 222 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 222 amino acids
Description : This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases. [provided by RefSeq
Molecular Mass : 52.2 kDa
AA Sequence : MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYRLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LXN latexin [ Homo sapiens ]
Official Symbol LXN
Synonyms LXN; latexin; MUM; tissue carboxypeptidase inhibitor; endogenous carboxypeptidase inhibitor; ECI; TCI;
Gene ID 56925
mRNA Refseq NM_020169
Protein Refseq NP_064554
MIM 609305
UniProt ID Q9BS40

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LXN Products

Required fields are marked with *

My Review for All LXN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon