Recombinant Full Length Human LY6D Protein, GST-tagged
| Cat.No. : | LY6D-6225HF |
| Product Overview : | Human LY6D full-length ORF ( AAH31330, 21 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 21-128 amino acids |
| Description : | LY6D (Lymphocyte Antigen 6 Family Member D) is a Protein Coding gene. Diseases associated with LY6D include Squamous Cell Carcinoma, Head And Neck. Among its related pathways are B Cell Development Pathways and Post-translational modification- synthesis of GPI-anchored proteins. |
| Molecular Mass : | 37.62 kDa |
| AA Sequence : | LRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LY6D lymphocyte antigen 6 complex, locus D [ Homo sapiens ] |
| Official Symbol | LY6D |
| Synonyms | LY6D; lymphocyte antigen 6 complex, locus D; lymphocyte antigen 6D; E48; e48 antigen; Ly-6D; |
| Gene ID | 8581 |
| mRNA Refseq | NM_003695 |
| Protein Refseq | NP_003686 |
| MIM | 606204 |
| UniProt ID | Q14210 |
| ◆ Recombinant Proteins | ||
| LY6D-9367M | Recombinant Mouse LY6D Protein | +Inquiry |
| LY6D-6225HF | Recombinant Full Length Human LY6D Protein, GST-tagged | +Inquiry |
| LY6D-4571H | Recombinant Human LY6D Protein, GST-tagged | +Inquiry |
| LY6D-418H | Recombinant Human lymphocyte antigen 6 complex, locus D, His-tagged | +Inquiry |
| LY6D-5250M | Recombinant Mouse LY6D Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LY6D-4602HCL | Recombinant Human LY6D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY6D Products
Required fields are marked with *
My Review for All LY6D Products
Required fields are marked with *
