Recombinant Full Length Human LY6D Protein, GST-tagged

Cat.No. : LY6D-6225HF
Product Overview : Human LY6D full-length ORF ( AAH31330, 21 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 21-128 amino acids
Description : LY6D (Lymphocyte Antigen 6 Family Member D) is a Protein Coding gene. Diseases associated with LY6D include Squamous Cell Carcinoma, Head And Neck. Among its related pathways are B Cell Development Pathways and Post-translational modification- synthesis of GPI-anchored proteins.
Molecular Mass : 37.62 kDa
AA Sequence : LRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPSYTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLLAVILAPSL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LY6D lymphocyte antigen 6 complex, locus D [ Homo sapiens ]
Official Symbol LY6D
Synonyms LY6D; lymphocyte antigen 6 complex, locus D; lymphocyte antigen 6D; E48; e48 antigen; Ly-6D;
Gene ID 8581
mRNA Refseq NM_003695
Protein Refseq NP_003686
MIM 606204
UniProt ID Q14210

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LY6D Products

Required fields are marked with *

My Review for All LY6D Products

Required fields are marked with *

0
cart-icon