Recombinant Full Length Human LY86 Protein, Flag-tagged
| Cat.No. : | LY86-1213H |
| Product Overview : | Recombinant Full Length Human LY86 Protein, Flag-tagged,expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Flag |
| Protein Length : | 1-162 aa |
| Description : | May cooperate with CD180 and TLR4 to mediate the innate immune response to bacterial lipopolysaccharide (LPS) and cytokine production. Important for efficient CD180 cell surface expression (By similarity). |
| Tag : | Flag |
| Molecular Mass : | 17.7 kDa |
| AA Sequence : | MKGFTATLFLWTLIFPSCSGGGGGKAWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRF GIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQV LLELYTEKRSTVACANATIMCSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80°C. |
| Concentration : | >0.05 μg/μL as determined by microplate BCA method |
| Storage Buffer : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Gene Name | LY86 lymphocyte antigen 86 [ Homo sapiens (human) ] |
| Official Symbol | LY86 |
| Synonyms | dJ80N2.1; MD-1; MD1; MMD-1;LY86 |
| Gene ID | 9450 |
| mRNA Refseq | NM_004271 |
| Protein Refseq | NP_004262 |
| MIM | 605241 |
| UniProt ID | O95711 |
| ◆ Recombinant Proteins | ||
| Ly86-806M | Recombinant Mouse Ly86 protein, His-tagged | +Inquiry |
| LY86-5343H | Recombinant Human LY86 Protein (Gly21-Ser162), C-Fc tagged | +Inquiry |
| LY86-1090H | Active Recombinant Human LY86 | +Inquiry |
| LY86-6230HF | Recombinant Full Length Human LY86 Protein, GST-tagged | +Inquiry |
| LY86-263H | Recombinant Human lymphocyte antigen 86, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LY86-2892MCL | Recombinant Mouse LY86 cell lysate | +Inquiry |
| LY86-1276HCL | Recombinant Human LY86 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY86 Products
Required fields are marked with *
My Review for All LY86 Products
Required fields are marked with *
