Recombinant Full Length Human LYG2 Protein, GST-tagged
Cat.No. : | LYG2-6234HF |
Product Overview : | Human LYG2 full-length ORF ( NP_783862.2, 1 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 212 amino acids |
Description : | The protein encoded by this gene contains a SLT domain, a protein domain present in bacterial lytic transglycosylase (SLT) and in eukaryotic lysozymes (GEWL). SLT domain catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyglucosamine (GlcNAc). [provided by RefSeq |
Molecular Mass : | 49.9 kDa |
AA Sequence : | MLSSVVFWGLIALIGTSRGSYPFSHSMKPHLHPRLYHGCYGDIMTMKTSGATCDANSVMNCGIRGSEMFAEMDLRAIKPYQTLIKEVGQRHCVDPAVIAAIISRESHGGSVLQDGWDHRGLKFGLMQLDKQTYHPVGAWDSKEHLSQATGILTERIKAIQKKFPTWSVAQHLKGGLSAFKSGIEAIATPSDIDNDFVNDIIARAKFYKRQSF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYG2 lysozyme G-like 2 [ Homo sapiens ] |
Official Symbol | LYG2 |
Synonyms | LYG2; lysozyme G-like 2; lysozyme g-like protein 2; LYGH; MGC119046; MGC119047; MGC119049; |
Gene ID | 254773 |
mRNA Refseq | NM_175735 |
Protein Refseq | NP_783862 |
MIM | 616547 |
UniProt ID | Q86SG7 |
◆ Recombinant Proteins | ||
LYG2-4168H | Recombinant Human LYG2 Protein (Ser20-Phe212), C-His tagged | +Inquiry |
LYG2-2603R | Recombinant Rhesus monkey LYG2 Protein, His-tagged | +Inquiry |
Lyg2-3876M | Recombinant Mouse Lyg2 Protein, Myc/DDK-tagged | +Inquiry |
LYG2-1113C | Recombinant Chicken LYG2 | +Inquiry |
LYG2-6234HF | Recombinant Full Length Human LYG2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYG2-4596HCL | Recombinant Human LYG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYG2 Products
Required fields are marked with *
My Review for All LYG2 Products
Required fields are marked with *