Recombinant Full Length Human Lymphocyte Activation Gene 3 Protein(Lag3) Protein, His-Tagged
Cat.No. : | RFL10567HF |
Product Overview : | Recombinant Full Length Human Lymphocyte activation gene 3 protein(LAG3) Protein (P18627) (23-525aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-525) |
Form : | Lyophilized powder |
AA Sequence : | LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | LAG3 |
Synonyms | CD223; CD223 antigen; FDC protein; LAG-3; Lag3; LAG3_HUMAN; Lymphocyte activating 3; Lymphocyte activation gene 3; Lymphocyte activation gene 3 protein; Protein FDC |
UniProt ID | P18627 |
◆ Recombinant Proteins | ||
Lag3-1083M | Recombinant Mouse Lag3 protein, His-tagged | +Inquiry |
LAG3-152H | Recombinant Human LAG3 Protein, His-tagged | +Inquiry |
LAG3-15H | Active Recombinant Human LAG3 protein(Met1-Leu450), mFc-tagged | +Inquiry |
LAG3-4401H | Recombinant Human LAG3 protein, His-tagged | +Inquiry |
LAG3-387M | Active Recombinant Marmoset LAG3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAG3-941RCL | Recombinant Rat LAG3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAG3 Products
Required fields are marked with *
My Review for All LAG3 Products
Required fields are marked with *
0
Inquiry Basket