Recombinant Full Length Human LYPLAL1 Protein, GST-tagged

Cat.No. : LYPLAL1-6246HF
Product Overview : Human LYPLAL1 full-length ORF ( NP_620149.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 237 amino acids
Description : LYPLAL1 (Lysophospholipase Like 1) is a Protein Coding gene. Diseases associated with LYPLAL1 include Peters Anomaly. GO annotations related to this gene include hydrolase activity and lysophospholipase activity. An important paralog of this gene is LYPLA1.
Molecular Mass : 52.7 kDa
AA Sequence : MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LYPLAL1 lysophospholipase-like 1 [ Homo sapiens ]
Official Symbol LYPLAL1
Synonyms LYPLAL1; lysophospholipase-like 1; lysophospholipase-like protein 1; Q96AV0; FLJ99730; KIAA1238;
Gene ID 127018
mRNA Refseq NM_138794
Protein Refseq NP_620149
MIM 616548
UniProt ID Q5VWZ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYPLAL1 Products

Required fields are marked with *

My Review for All LYPLAL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon