Recombinant Full Length Human LYPLAL1 Protein, GST-tagged
| Cat.No. : | LYPLAL1-6246HF |
| Product Overview : | Human LYPLAL1 full-length ORF ( NP_620149.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 237 amino acids |
| Description : | LYPLAL1 (Lysophospholipase Like 1) is a Protein Coding gene. Diseases associated with LYPLAL1 include Peters Anomaly. GO annotations related to this gene include hydrolase activity and lysophospholipase activity. An important paralog of this gene is LYPLA1. |
| Molecular Mass : | 52.7 kDa |
| AA Sequence : | MAAASGSVLQRCIVSPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQDLTFQHIKIIYPTAPPRSYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEEVKSGIKKNRILIGGFSMGGCMAMHLAYRNHQDVAGVFALSSFLNKASAVYQALQKSNGVLPELFQCHGTADELVLHSWAEETNSMLKSLGVTTKFHSFPNVYHELSKTELDILKLWILTKLPGEMEKQK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LYPLAL1 lysophospholipase-like 1 [ Homo sapiens ] |
| Official Symbol | LYPLAL1 |
| Synonyms | LYPLAL1; lysophospholipase-like 1; lysophospholipase-like protein 1; Q96AV0; FLJ99730; KIAA1238; |
| Gene ID | 127018 |
| mRNA Refseq | NM_138794 |
| Protein Refseq | NP_620149 |
| MIM | 616548 |
| UniProt ID | Q5VWZ2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPLAL1 Products
Required fields are marked with *
My Review for All LYPLAL1 Products
Required fields are marked with *



