Recombinant Full Length Human LYSMD4 Protein, GST-tagged

Cat.No. : LYSMD4-6037HF
Product Overview : Human LYSMD4 full-length ORF ( NP_689662.2, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 297 amino acids
Description : LYSMD4 (LysM Domain Containing 4) is a Protein Coding gene. An important paralog of this gene is LYSMD3.
Molecular Mass : 58.5 kDa
AA Sequence : MAVGTRGTLLKKSLTVWFCGPGARSATRAVSTSLPRREQVTWCCCSGSWPRRTASTSWRCSMAANFCRHTVWLTEHGLKNEACPTKTGIDGVGFLVADIKKVNNFIREQDLYALKSVKIPVRNHGILMETHKELKPLLSPSSETTVTVELPEADRAGAGTGAQAGQLMGFFKGIDQDIERAVQSEIFLHESYCMDTSHQPLLPAPPKTPMDGADCGIQWWNAVFIMLLIGIVLPVFYLVYFKIQASGETPNSLNTTVIPNGSMAMGTVPGQAPRLAVAVPAVTSADSQFSQTTQAGS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LYSMD4 LysM, putative peptidoglycan-binding, domain containing 4 [ Homo sapiens ]
Official Symbol LYSMD4
Synonyms LYSMD4; LysM, putative peptidoglycan-binding, domain containing 4; lysM and putative peptidoglycan-binding domain-containing protein 4; FLJ33008; MGC99501;
Gene ID 145748
mRNA Refseq NM_152449
Protein Refseq NP_689662
UniProt ID Q5XG99

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LYSMD4 Products

Required fields are marked with *

My Review for All LYSMD4 Products

Required fields are marked with *

0
cart-icon
0
compare icon