Recombinant Full Length Human MAFG Protein, C-Flag-tagged

Cat.No. : MAFG-1149HFL
Product Overview : Recombinant Full Length Human MAFG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Globin gene expression is regulated through nuclear factor erythroid-2 (NFE2) elements located in enhancer-like locus control regions positioned many kb upstream of alpha- and beta-gene clusters. NFE2 DNA-binding activity consists of a heterodimer containing a ubiquitous small Maf protein and the tissue-restricted protein p45 NFE2. Both subunits are members of the activator protein-1-like superfamily of basic leucine zipper (bZIP) proteins.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 17.7 kDa
AA Sequence : MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRV KRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFARTVARSPVAPARGPLAAGLGPL
VPGKVAATSVITIVKSKTDARSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Transcription Factors
Full Length : Full L.
Gene Name MAFG MAF bZIP transcription factor G [ Homo sapiens (human) ]
Official Symbol MAFG
Synonyms hMAF
Gene ID 4097
mRNA Refseq NM_002359.4
Protein Refseq NP_002350.1
MIM 602020
UniProt ID O15525

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAFG Products

Required fields are marked with *

My Review for All MAFG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon