Recombinant Full Length Human MAFG Protein, C-Flag-tagged
Cat.No. : | MAFG-1149HFL |
Product Overview : | Recombinant Full Length Human MAFG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Globin gene expression is regulated through nuclear factor erythroid-2 (NFE2) elements located in enhancer-like locus control regions positioned many kb upstream of alpha- and beta-gene clusters. NFE2 DNA-binding activity consists of a heterodimer containing a ubiquitous small Maf protein and the tissue-restricted protein p45 NFE2. Both subunits are members of the activator protein-1-like superfamily of basic leucine zipper (bZIP) proteins. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 17.7 kDa |
AA Sequence : | MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLKNRGYAASCRV KRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFARTVARSPVAPARGPLAAGLGPL VPGKVAATSVITIVKSKTDARSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Full Length : | Full L. |
Gene Name | MAFG MAF bZIP transcription factor G [ Homo sapiens (human) ] |
Official Symbol | MAFG |
Synonyms | hMAF |
Gene ID | 4097 |
mRNA Refseq | NM_002359.4 |
Protein Refseq | NP_002350.1 |
MIM | 602020 |
UniProt ID | O15525 |
◆ Recombinant Proteins | ||
Mafg-3900M | Recombinant Mouse Mafg Protein, Myc/DDK-tagged | +Inquiry |
MAFG-3528C | Recombinant Chicken MAFG | +Inquiry |
MAFG-1337H | Recombinant Human MAFG Protein, His (Fc)-Avi-tagged | +Inquiry |
MAFG-1149HFL | Recombinant Full Length Human MAFG Protein, C-Flag-tagged | +Inquiry |
MAFG-2444R | Recombinant Rhesus Macaque MAFG Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAFG-4559HCL | Recombinant Human MAFG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAFG Products
Required fields are marked with *
My Review for All MAFG Products
Required fields are marked with *
0
Inquiry Basket