Recombinant Full Length Human MAGEA12 Protein

Cat.No. : MAGEA12-294HF
Product Overview : Recombinant full length Human MAGEA12 with N terminal proprietary tag; Predicted MWt 60.61 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 314 amino acids
Description : This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Form : Liquid
Molecular Mass : 60.010kDa inclusive of tags
AA Sequence : MPLEQRSQHCKPEEGLEAQGEALGLVGAQAPATEEQETAS SSSTLVEVTLREVPAAESPSPPHSPQGASTLPTTINYTLW SQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFL LLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQL VFGIEVVEVVRIGHLYILVTCLGLSYDGLLGDNQIVPKTG LLIIVLAIIAKEGDCAPEEKIWEELSVLEASDGREDSVFA HPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGPRALVE TSYVKVLHHLLKISGGPHISYPPLHEWAFREGEE
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name MAGEA12 melanoma antigen family A, 12 [ Homo sapiens ]
Official Symbol MAGEA12
Synonyms MAGEA12; melanoma antigen family A, 12; MAGE12; melanoma-associated antigen 12; cancer/testis antigen family 1; member 12; CT1.12
Gene ID 4111
mRNA Refseq NM_001166386
Protein Refseq NP_001159858
MIM 300177
UniProt ID P43365

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAGEA12 Products

Required fields are marked with *

My Review for All MAGEA12 Products

Required fields are marked with *

0
cart-icon