Recombinant Full Length Human MAGEA12 Protein
| Cat.No. : | MAGEA12-294HF |
| Product Overview : | Recombinant full length Human MAGEA12 with N terminal proprietary tag; Predicted MWt 60.61 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 314 amino acids |
| Description : | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
| Form : | Liquid |
| Molecular Mass : | 60.010kDa inclusive of tags |
| AA Sequence : | MPLEQRSQHCKPEEGLEAQGEALGLVGAQAPATEEQETAS SSSTLVEVTLREVPAAESPSPPHSPQGASTLPTTINYTLW SQSDEGSSNEEQEGPSTFPDLETSFQVALSRKMAELVHFL LLKYRAREPFTKAEMLGSVIRNFQDFFPVIFSKASEYLQL VFGIEVVEVVRIGHLYILVTCLGLSYDGLLGDNQIVPKTG LLIIVLAIIAKEGDCAPEEKIWEELSVLEASDGREDSVFA HPRKLLTQDLVQENYLEYRQVPGSDPACYEFLWGPRALVE TSYVKVLHHLLKISGGPHISYPPLHEWAFREGEE |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | MAGEA12 melanoma antigen family A, 12 [ Homo sapiens ] |
| Official Symbol | MAGEA12 |
| Synonyms | MAGEA12; melanoma antigen family A, 12; MAGE12; melanoma-associated antigen 12; cancer/testis antigen family 1; member 12; CT1.12 |
| Gene ID | 4111 |
| mRNA Refseq | NM_001166386 |
| Protein Refseq | NP_001159858 |
| MIM | 300177 |
| UniProt ID | P43365 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAGEA12 Products
Required fields are marked with *
My Review for All MAGEA12 Products
Required fields are marked with *



