Recombinant Full Length Human Magnesium Transporter Protein 1(Magt1) Protein, His-Tagged
| Cat.No. : | RFL12122HF |
| Product Overview : | Recombinant Full Length Human Magnesium transporter protein 1(MAGT1) Protein (Q9H0U3) (30-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (30-335) |
| Form : | Lyophilized powder |
| AA Sequence : | QRKKEMVLSEKVSQLMEWTNKRPVIRMNGDKFRRLVKAPPRNYSVIVMFTALQLHRQCVV CKQADEEFQILANSWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPAKGKPK RGDTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSN MEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAET HIVLLFNGGVTLGMVLLCEAATSDMDIGKRKIMCVAGIGLVVLFFSWMLSIFRSKYHGYP YSFLMS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MAGT1 |
| Synonyms | MAGT1; IAG2; PSEC0084; UNQ628/PRO1244; Magnesium transporter protein 1; MagT1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1; Oligosaccharyl transferase subunit MAGT1; Implantation-associated protein; IAP |
| UniProt ID | Q9H0U3 |
| ◆ Recombinant Proteins | ||
| RFL700RF | Recombinant Full Length Rat Magnesium Transporter Protein 1(Magt1) Protein, His-Tagged | +Inquiry |
| MAGT1-10097Z | Recombinant Zebrafish MAGT1 | +Inquiry |
| RFL30872PF | Recombinant Full Length Pongo Abelii Magnesium Transporter Protein 1(Magt1) Protein, His-Tagged | +Inquiry |
| MAGT1-3202R | Recombinant Rat MAGT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Magt1-16R | Recombinant Rat Magt1 protein, His/SUMO-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAGT1-4532HCL | Recombinant Human MAGT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAGT1 Products
Required fields are marked with *
My Review for All MAGT1 Products
Required fields are marked with *
