Recombinant Rat Magt1 protein, His/SUMO-tagged
Cat.No. : | Magt1-16R |
Product Overview : | Recombinant Rat Magt1(30-335 aa) fused with His/SUMO tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 30-335 aa |
Description : | Magt1 played an important role in many functions. |
Form : | Tris-based buffer,50% glycerol |
AA Sequence : | QRKKEKVLVEKVIQLMEWTNQRPVIRMNGDKFRPLVKAPPRNYSVIVMFTALQLHRQCVV CKQADEEFQILANFWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPPKGKPK RADTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSN MEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAET HIVLLFNGGVTLGMVLLCEAAASDMDIGKRRMMCIAGIGLVVLFFSWMLSIFRSKYHGYP YSFLMS |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. |
Gene Name | Magt1 magnesium transporter 1 [ Rattus norvegicus ] |
Official Symbol | Magt1 |
Synonyms | MAGT1; magnesium transporter 1; magnesium transporter protein 1; IAP; implantation-associated protein; Iag2; |
Gene ID | 116967 |
mRNA Refseq | NM_053946 |
Protein Refseq | NP_446398 |
UniProt ID | O35777 |
Chromosome Location | Xq22 |
Function | magnesium ion transmembrane transporter activity; |
◆ Recombinant Proteins | ||
Magt1-16R | Recombinant Rat Magt1 protein, His/SUMO-tagged | +Inquiry |
MAGT1-10097Z | Recombinant Zebrafish MAGT1 | +Inquiry |
RFL700RF | Recombinant Full Length Rat Magnesium Transporter Protein 1(Magt1) Protein, His-Tagged | +Inquiry |
MAGT1-1576C | Recombinant Chicken MAGT1 | +Inquiry |
RFL15710DF | Recombinant Full Length Danio Rerio Magnesium Transporter Protein 1(Magt1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGT1-4532HCL | Recombinant Human MAGT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Magt1 Products
Required fields are marked with *
My Review for All Magt1 Products
Required fields are marked with *