Recombinant Rat Magt1 protein, His/SUMO-tagged
| Cat.No. : | Magt1-16R |
| Product Overview : | Recombinant Rat Magt1(30-335 aa) fused with His/SUMO tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 30-335 aa |
| Description : | Magt1 played an important role in many functions. |
| Form : | Tris-based buffer,50% glycerol |
| AA Sequence : | QRKKEKVLVEKVIQLMEWTNQRPVIRMNGDKFRPLVKAPPRNYSVIVMFTALQLHRQCVV CKQADEEFQILANFWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPPKGKPK RADTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSN MEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAET HIVLLFNGGVTLGMVLLCEAAASDMDIGKRRMMCIAGIGLVVLFFSWMLSIFRSKYHGYP YSFLMS |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. |
| Gene Name | Magt1 magnesium transporter 1 [ Rattus norvegicus ] |
| Official Symbol | Magt1 |
| Synonyms | MAGT1; magnesium transporter 1; magnesium transporter protein 1; IAP; implantation-associated protein; Iag2; |
| Gene ID | 116967 |
| mRNA Refseq | NM_053946 |
| Protein Refseq | NP_446398 |
| UniProt ID | O35777 |
| Chromosome Location | Xq22 |
| Function | magnesium ion transmembrane transporter activity; |
| ◆ Recombinant Proteins | ||
| RFL30872PF | Recombinant Full Length Pongo Abelii Magnesium Transporter Protein 1(Magt1) Protein, His-Tagged | +Inquiry |
| MAGT1-3202R | Recombinant Rat MAGT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Magt1-16R | Recombinant Rat Magt1 protein, His/SUMO-tagged | +Inquiry |
| RFL27058MF | Recombinant Full Length Mouse Magnesium Transporter Protein 1(Magt1) Protein, His-Tagged | +Inquiry |
| MAGT1-3546R | Recombinant Rat MAGT1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAGT1-4532HCL | Recombinant Human MAGT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Magt1 Products
Required fields are marked with *
My Review for All Magt1 Products
Required fields are marked with *
