Recombinant Full Length Rat Magnesium Transporter Protein 1(Magt1) Protein, His-Tagged
Cat.No. : | RFL700RF |
Product Overview : | Recombinant Full Length Rat Magnesium transporter protein 1(Magt1) Protein (O35777) (30-335aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (30-335) |
Form : | Lyophilized powder |
AA Sequence : | QRKKEKVLVEKVIQLMEWTNQRPVIRMNGDKFRPLVKAPPRNYSVIVMFTALQLHRQCVV CKQADEEFQILANFWRYSSAFTNRIFFAMVDFDEGSDVFQMLNMNSAPTFINFPPKGKPK RADTYELQVRGFSAEQIARWIADRTDVNIRVIRPPNYAGPLMLGLLLAVIGGLVYLRRSN MEFLFNKTGWAFAALCFVLAMTSGQMWNHIRGPPYAHKNPHTGHVNYIHGSSQAQFVAET HIVLLFNGGVTLGMVLLCEAAASDMDIGKRRMMCIAGIGLVVLFFSWMLSIFRSKYHGYP YSFLMS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Magt1 |
Synonyms | Magt1; Iag2; Magnesium transporter protein 1; MagT1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit MAGT1; Oligosaccharyl transferase subunit MAGT1; Implantation-associated protein; IAP |
UniProt ID | O35777 |
◆ Recombinant Proteins | ||
MAGT1-3202R | Recombinant Rat MAGT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30872PF | Recombinant Full Length Pongo Abelii Magnesium Transporter Protein 1(Magt1) Protein, His-Tagged | +Inquiry |
RFL12122HF | Recombinant Full Length Human Magnesium Transporter Protein 1(Magt1) Protein, His-Tagged | +Inquiry |
MAGT1-3546R | Recombinant Rat MAGT1 Protein | +Inquiry |
Magt1-16R | Recombinant Rat Magt1 protein, His/SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGT1-4532HCL | Recombinant Human MAGT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Magt1 Products
Required fields are marked with *
My Review for All Magt1 Products
Required fields are marked with *
0
Inquiry Basket