Recombinant Full Length Human MAJIN Protein, GST-tagged

• Cat.No.: MAJIN-1984HF
• Product Overview: Human MAJIN full-length ORF ( NP_001032302.1, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 216 amino acids
• Description: Predicted to enable DNA binding activity. Predicted to be involved in homologous chromosome pairing at meiosis and meiotic attachment of telomere to nuclear envelope. Predicted to be located in chromosome, telomeric region. Predicted to be integral component of nuclear inner membrane.
• Molecular Mass: 51.2 kDa
• AA Sequence: MSLKPFTYPFPETRFLHAGPNVYKFKIRYGKSIRGEEIENKEVITQELEDSVRVVLGNLDNLQPFATEHFIVFPYKSKWERVSHLKFKHGEIILIPYPFVFTLYVEMKWFHENLSPGKPISDSPLGLVPVEKKAVGAVMRKRKHMDEPSSPSRPGLDRIGKEKPNKDCRRLWPLISLMSRNKILSGDTACQGELSHPCSTTHLHLRSEQPPASLGF
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MAJIN membrane anchored junction protein [ Homo sapiens (human) ]
• Official Symbol: MAJIN
• Synonyms: C11ORF85; chromosome 11 open reading frame 85; uncharacterized protein C11orf85; hypothetical protein LOC283129; LOC283129; MGC126364
• Gene ID: 283129
• mRNA Refseq: NM_001037225
• Protein Refseq: NP_001032302
• MIM: 617130
• UniProt ID: Q3KP22