Recombinant Full Length Human MAL2 Protein, GST-tagged
Cat.No. : | MAL2-6874HF |
Product Overview : | Human MAL2 full-length ORF ( AAH12367, 1 a.a. - 176 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 176 amino acids |
Description : | This gene encodes a multispan transmembrane protein belonging to the MAL proteolipid family. The protein is a component of lipid rafts and, in polarized cells, it primarily localizes to endosomal structures beneath the apical membrane. It is required for transcytosis, an intracellular transport pathway used to deliver membrane-bound proteins and exogenous cargos from the basolateral to the apical surface. |
Molecular Mass : | 44.99 kDa |
AA Sequence : | MSAGGASVPPPPNPAVSFPPPRVTLPAGPDILRTYSGAFVCLEILFGGLVWILVASSNVPLPLLQGWVMFVSVTAFFFSLLFLGMFLSGMVAQIDANWNFLDFAYHFTVFVFYFGAFLLEAAATSLHDLHCNTTITGQPLLSDNQYNINVAASIFAFMTTACYGCSLGLALRRWRP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MAL2 mal, T cell differentiation protein 2 [ Homo sapiens (human) ] |
Official Symbol | MAL2 |
Synonyms | MAL2; mal, T cell differentiation protein 2; protein MAL2; MAL proteolipid protein 2; MAL2 proteolipid protein; myelin and lymphocyte protein |
Gene ID | 114569 |
mRNA Refseq | NM_052886 |
Protein Refseq | NP_443118 |
MIM | 609684 |
UniProt ID | Q969L2 |
◆ Recombinant Proteins | ||
RFL28013MF | Recombinant Full Length Mouse Protein Mal2(Mal2) Protein, His-Tagged | +Inquiry |
MAL2-1927C | Recombinant Chicken MAL2 | +Inquiry |
RFL26268HF | Recombinant Full Length Human Protein Mal2(Mal2) Protein, His-Tagged | +Inquiry |
MAL2-6874HF | Recombinant Full Length Human MAL2 Protein, GST-tagged | +Inquiry |
RFL166BF | Recombinant Full Length Bovine Protein Mal2(Mal2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAL2-4529HCL | Recombinant Human MAL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAL2 Products
Required fields are marked with *
My Review for All MAL2 Products
Required fields are marked with *