Recombinant Full Length Human MBLAC2 Protein, C-Flag-tagged
Cat.No. : | MBLAC2-1242HFL |
Product Overview : | Recombinant Full Length Human MBLAC2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables palmitoyl-CoA hydrolase activity. Located in endoplasmic reticulum membrane and plasma membrane. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 31.2 kDa |
AA Sequence : | MSALEWYAHKSLGDGIFWIQERFYESGNRANIWLVRGSEQDVVIDTGLGLRSLPEYLYSSGLLQDREAKE DAARRPLLAVATHVHFDHSGGLYQFDRVAVHHAEAEALARGDNFETVTWLSDSEVVRAPSPGWRARQFRV QAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGDVVYDGSLIDWLPYSRISDYVG TCERLIELVDRGLVEKVLPGHFNTFGAERLFRLASNYISKAGICHKVSTFAMRSLASLALRVTNSRTSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MBLAC2 metallo-beta-lactamase domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | MBLAC2 |
Synonyms | DKFZp686P15118; MGC46734 |
Gene ID | 153364 |
mRNA Refseq | NM_203406.2 |
Protein Refseq | NP_981951.2 |
UniProt ID | Q68D91 |
◆ Recombinant Proteins | ||
MBLAC2-6659Z | Recombinant Zebrafish MBLAC2 | +Inquiry |
MBLAC2-1242HFL | Recombinant Full Length Human MBLAC2 Protein, C-Flag-tagged | +Inquiry |
MBLAC2-1548H | Recombinant Human MBLAC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MBLAC2-2515R | Recombinant Rhesus Macaque MBLAC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Mblac2-3981M | Recombinant Mouse Mblac2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MBLAC2-4442HCL | Recombinant Human MBLAC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBLAC2 Products
Required fields are marked with *
My Review for All MBLAC2 Products
Required fields are marked with *