Recombinant Full Length Human MBLAC2 Protein, C-Flag-tagged

• Cat.No.: MBLAC2-1242HFL
• Product Overview: Recombinant Full Length Human MBLAC2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables palmitoyl-CoA hydrolase activity. Located in endoplasmic reticulum membrane and plasma membrane.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 31.2 kDa
• AA Sequence: MSALEWYAHKSLGDGIFWIQERFYESGNRANIWLVRGSEQDVVIDTGLGLRSLPEYLYSSGLLQDREAKE DAARRPLLAVATHVHFDHSGGLYQFDRVAVHHAEAEALARGDNFETVTWLSDSEVVRAPSPGWRARQFRV QAVQPTLILQDGDVINLGDRQLTVMHMPGHSRGSICLHDKDRKILFSGDVVYDGSLIDWLPYSRISDYVG TCERLIELVDRGLVEKVLPGHFNTFGAERLFRLASNYISKAGICHKVSTFAMRSLASLALRVTNSRTSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Full Length: Full L.

Gene Information

• Gene Name: MBLAC2 metallo-beta-lactamase domain containing 2 [ Homo sapiens (human) ]
• Official Symbol: MBLAC2
• Synonyms: DKFZp686P15118; MGC46734
• Gene ID: 153364
• mRNA Refseq: NM_203406.2
• Protein Refseq: NP_981951.2
• UniProt ID: Q68D91