Recombinant Full Length Human MDFI Protein, GST-tagged

Cat.No. : MDFI-6101HF
Product Overview : Human MDFI full-length ORF ( NP_005577.1, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 246 amino acids
Description : This protein is a transcription factor that negatively regulates other myogenic family proteins. Studies of the mouse homolog, I-mf, show that it interferes with myogenic factor function by masking nuclear localization signals and preventing DNA binding. Knockout mouse studies show defects in the formation of vertebrae and ribs that also involve cartilage formation in these structures. [provided by RefSeq
Molecular Mass : 51.4 kDa
AA Sequence : MYQVSGQRPSGCDAPYGAPSAAPGPAQTLSLLPGLEVVTGSTHPAEAAPEEGSLEEAATPMPQGNGPGIPQGLDSTDLDVPTEAVTCQPQGNPLGCTPLLPNDSGHPSELGGTRRAGNGALGGPKAHRKLQTHPSLASQGSKKSKSSSKSTTSQIPLQAQEDCCVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCLCCCCCGSGECADCDLPCDLDCGILDACCESADCLEICMECCGLCFSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MDFI MyoD family inhibitor [ Homo sapiens ]
Official Symbol MDFI
Synonyms MDFI; MyoD family inhibitor; myoD family inhibitor; I mfa; inhibitor of MyoD family a; myogenic repressor I-mf; I-MF; I-mfa;
Gene ID 4188
mRNA Refseq NM_005586
Protein Refseq NP_005577
MIM 604971
UniProt ID Q99750

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MDFI Products

Required fields are marked with *

My Review for All MDFI Products

Required fields are marked with *

0

Inquiry Basket

cartIcon