Recombinant Full Length Human MDFI Protein, GST-tagged
| Cat.No. : | MDFI-6101HF |
| Product Overview : | Human MDFI full-length ORF ( NP_005577.1, 1 a.a. - 246 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 246 amino acids |
| Description : | This protein is a transcription factor that negatively regulates other myogenic family proteins. Studies of the mouse homolog, I-mf, show that it interferes with myogenic factor function by masking nuclear localization signals and preventing DNA binding. Knockout mouse studies show defects in the formation of vertebrae and ribs that also involve cartilage formation in these structures. [provided by RefSeq |
| Molecular Mass : | 51.4 kDa |
| AA Sequence : | MYQVSGQRPSGCDAPYGAPSAAPGPAQTLSLLPGLEVVTGSTHPAEAAPEEGSLEEAATPMPQGNGPGIPQGLDSTDLDVPTEAVTCQPQGNPLGCTPLLPNDSGHPSELGGTRRAGNGALGGPKAHRKLQTHPSLASQGSKKSKSSSKSTTSQIPLQAQEDCCVHCILSCLFCEFLTLCNIVLDCATCGSCSSEDSCLCCCCCGSGECADCDLPCDLDCGILDACCESADCLEICMECCGLCFSS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MDFI MyoD family inhibitor [ Homo sapiens ] |
| Official Symbol | MDFI |
| Synonyms | MDFI; MyoD family inhibitor; myoD family inhibitor; I mfa; inhibitor of MyoD family a; myogenic repressor I-mf; I-MF; I-mfa; |
| Gene ID | 4188 |
| mRNA Refseq | NM_005586 |
| Protein Refseq | NP_005577 |
| MIM | 604971 |
| UniProt ID | Q99750 |
| ◆ Recombinant Proteins | ||
| MDFI-2530R | Recombinant Rhesus Macaque MDFI Protein, His (Fc)-Avi-tagged | +Inquiry |
| Mdfi-4873M | Recombinant Mouse Mdfi protein | +Inquiry |
| Mdfi-4870M | Recombinant Mouse Mdfi protein, Avi-tagged, Biotinylated | +Inquiry |
| Mdfi-4877M | Recombinant Mouse Mdfi protein | +Inquiry |
| Mdfi-4871M | Recombinant Mouse Mdfi protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MDFI Products
Required fields are marked with *
My Review for All MDFI Products
Required fields are marked with *
