Recombinant Full Length Human ME2 Protein, C-Flag-tagged
| Cat.No. : | ME2-198HFL |
| Product Overview : | Recombinant Full Length Human ME2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a mitochondrial NAD-dependent malic enzyme, a homotetrameric protein, that catalyzes the oxidative decarboxylation of malate to pyruvate. It had previously been weakly linked to a syndrome known as Friedreich ataxia that has since been shown to be the result of mutation in a completely different gene. Certain single-nucleotide polymorphism haplotypes of this gene have been shown to increase the risk for idiopathic generalized epilepsy. Alternatively spliced transcript variants encoding different isoforms found for this gene. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 63.4 kDa |
| AA Sequence : | MLSRLRVVSTTCTLACRHLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHR NLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDR GHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNI ALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREKYCTFNDDI QGTAAVALAGLLAAQKVISKPISEHKILFLGAGEAALGIANLIVMSMVENGLSEQEAQKKIWMFDKYGLL VKGRKAKIDSYQEPFTHSAPESIPDTFEDAVNILKPSTIIGVAGAGRLFTPDVIRAMASINERPVIFALS NPTAQAECTAEEAYTLTEGRCLFASGSPFGPVKLTDGRVFTPGQGNNVYIFPGVALAVILCNTRHISDSV FLEAAKALTSQLTDEELAQGRLYPPLANIQEVSINIAIKVTEYLYANKMAFRYPEPEDKAKYVKERTWRS EYDSLLPDVYEWPESASSPPVITETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Pathways : | Pyruvate metabolism |
| Full Length : | Full L. |
| Gene Name | ME2 malic enzyme 2 [ Homo sapiens (human) ] |
| Official Symbol | ME2 |
| Synonyms | ODS1 |
| Gene ID | 4200 |
| mRNA Refseq | NM_002396.5 |
| Protein Refseq | NP_002387.1 |
| MIM | 154270 |
| UniProt ID | P23368 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ME2 Products
Required fields are marked with *
My Review for All ME2 Products
Required fields are marked with *



