Recombinant Full Length Human MEDAG Protein, GST-tagged

• Cat.No.: MEDAG-1779HF
• Product Overview: Human MEDAG full-length ORF (BAB70975.1, 1 a.a. - 303 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 303 amino acids
• Description: Predicted to be involved in positive regulation of fat cell differentiation. Located in cytoplasm.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 60.5 kDa
• AA Sequence: MAGAACEPVARPSLTSISSGELRSLWTCDCELALLPLAQLLRLQPGAFQLSGDQLVVAGPGEPAAARGGFNVFGDGLVRLDGQLYRLSSYIKRYVELTNYCDYKDYRETILSKPMLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESYRLQFDFQEAVKNFFPPGNEVVNGENLSFAYEFKADALFDFFYWFGLSNSVVKVNGKVLNLSSTSPEKKETIKLFLEKMSEPLIRRSSFSDRKFSVTSRGSIDDVFNCNLSPRSSLTEPLLAELPFPSVLESEETPNQFI
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MEDAG mesenteric estrogen dependent adipogenesis [ Homo sapiens (human) ]
• Official Symbol: MEDAG
• Synonyms: C13ORF33; chromosome 13 open reading frame 33; uncharacterized protein C13orf33; AWMS3; FLJ14834; activated in W/Wv mouse stomach 3 homolog; hAWMS3; MGC126673; MGC126675
• Gene ID: 84935
• mRNA Refseq: NM_032849
• Protein Refseq: NP_116238
• UniProt ID: Q5VYS4