Recombinant Full Length Human Melanocortin-2 Receptor Accessory Protein 2(Mrap2) Protein, His-Tagged
| Cat.No. : | RFL15801HF |
| Product Overview : | Recombinant Full Length Human Melanocortin-2 receptor accessory protein 2(MRAP2) Protein (Q96G30) (1-205aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-205) |
| Form : | Lyophilized powder |
| AA Sequence : | MSAQRLISNRTSQQSASNSDYTWEYEYYEIGPVSFEGLKAHKYSIVIGFWVGLAVFVIFM FFVLTLLTKTGAPHQDNAESSEKRFRMNSFVSDFGRPLEPDKVFSRQGNEESRSLFHCYI NEVERLDRAKACHQTTALDSDVQLQEAIRSSGQPEEELNRLMKFDIPNFVNTDQNYFGED DLLISEPPIVLETKPLSQTSHKDLD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MRAP2 |
| Synonyms | MRAP2; C6orf117; Melanocortin-2 receptor accessory protein 2; MC2R accessory protein 2 |
| UniProt ID | Q96G30 |
| ◆ Recombinant Proteins | ||
| MRAP2-2820R | Recombinant Rhesus monkey MRAP2 Protein, His-tagged | +Inquiry |
| MRAP2-3501H | Recombinant Human MRAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL15801HF | Recombinant Full Length Human Melanocortin-2 Receptor Accessory Protein 2(Mrap2) Protein, His-Tagged | +Inquiry |
| MRAP2-5532H | Recombinant Human MRAP2 Protein, GST-tagged | +Inquiry |
| MRAP2-10010M | Recombinant Mouse MRAP2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MRAP2-4214HCL | Recombinant Human MRAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MRAP2 Products
Required fields are marked with *
My Review for All MRAP2 Products
Required fields are marked with *
