Recombinant Full Length Human METAP1 Protein, GST-tagged

Cat.No. : METAP1-6150HF
Product Overview : Human METAP1 full-length ORF ( NP_055958.1, 1 a.a. - 272 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 272 amino acids
Description : METAP1 (Methionyl Aminopeptidase 1) is a Protein Coding gene. Among its related pathways are Metabolism of fat-soluble vitamins and Signaling by GPCR. GO annotations related to this gene include hydrolase activity and metalloexopeptidase activity. An important paralog of this gene is METAP1D.
Molecular Mass : 56.8 kDa
AA Sequence : MSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMSQF
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name METAP1 methionyl aminopeptidase 1 [ Homo sapiens ]
Official Symbol METAP1
Synonyms METAP1; methionyl aminopeptidase 1; methionine aminopeptidase 1; KIAA0094; MAP1A; MetAP1A; Peptidase M; MAP 1; metAP 1; peptidase M 1; DKFZp781C0419;
Gene ID 23173
mRNA Refseq NM_015143
Protein Refseq NP_055958
MIM 610151
UniProt ID P53582

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All METAP1 Products

Required fields are marked with *

My Review for All METAP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon