Recombinant Full Length Human METAP1 Protein, GST-tagged
Cat.No. : | METAP1-6150HF |
Product Overview : | Human METAP1 full-length ORF ( NP_055958.1, 1 a.a. - 272 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 272 amino acids |
Description : | METAP1 (Methionyl Aminopeptidase 1) is a Protein Coding gene. Among its related pathways are Metabolism of fat-soluble vitamins and Signaling by GPCR. GO annotations related to this gene include hydrolase activity and metalloexopeptidase activity. An important paralog of this gene is METAP1D. |
Molecular Mass : | 56.8 kDa |
AA Sequence : | MSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREVLDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVFTIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEHTLLVTDTGCEILTRRLDSARPHFMSQF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | METAP1 methionyl aminopeptidase 1 [ Homo sapiens ] |
Official Symbol | METAP1 |
Synonyms | METAP1; methionyl aminopeptidase 1; methionine aminopeptidase 1; KIAA0094; MAP1A; MetAP1A; Peptidase M; MAP 1; metAP 1; peptidase M 1; DKFZp781C0419; |
Gene ID | 23173 |
mRNA Refseq | NM_015143 |
Protein Refseq | NP_055958 |
MIM | 610151 |
UniProt ID | P53582 |
◆ Recombinant Proteins | ||
METAP1-202H | Recombinant Human METAP1 Protein, His-tagged | +Inquiry |
NUDT16-954H | Recombinant Human NUDT16, His-tagged | +Inquiry |
NUDT16-152H | Recombinant Human NUDT16 Protein, His-tagged | +Inquiry |
NUDT16-237H | Recombinant Human NUDT16 protein, T7/His-tagged | +Inquiry |
NUDT16-2326H | Recombinant Human NUDT16 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDT16-447HCL | Recombinant Human NUDT16 lysate | +Inquiry |
METAP1-2887HCL | Recombinant Human METAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METAP1 Products
Required fields are marked with *
My Review for All METAP1 Products
Required fields are marked with *