Recombinant Full Length Human METTL18 Protein, GST-tagged

Cat.No. : METTL18-6165HF
Product Overview : Human METTL18 full-length ORF (BAG36632.1, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 372 amino acids
Description : METTL18 (Methyltransferase Like 18) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity and protein methyltransferase activity.
Molecular Mass : 67.32 kDa
AA Sequence : MTFQFNFTIEDHLENELTPIRDGALTLDSSKELSVSESQKGEERDRKCSAEQFDLPQDHLWEHKSMENAAPSQDTDSPLSAASSSRNLEPHGKQPSLRAAKEHAMPKDLKKMLENKVIETLPGFQHVKLSVVKTILLKENFPGENIVSKSFSSHSDLITGVYEGGLKIWECTFDLLAYFTKAKVKFAGKKVLDLGCGSGLLGITAFKGGSKEIHFQDYNSMVIDEVTLPNVVANSTLEDEENDVNEPDVKRCRKPKVTQLYKCRFFSGEWSEFCKLVLSSEKLFVKYDLILTSETIYNPDYYSNLHQTFLRLLSKNGRVLLASKAHYFGVGGGVHLFQKFVEERDVFKTRILKIIDEGLKRFIIEITFKFPG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name METTL18 methyltransferase like 18 [ Homo sapiens ]
Official Symbol METTL18
Synonyms HPM1; AsTP2; C1orf156; RP1-117P20.4
Gene ID 92342
mRNA Refseq NM_033418
Protein Refseq NP_219486
MIM 615255
UniProt ID O95568

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All METTL18 Products

Required fields are marked with *

My Review for All METTL18 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon