Recombinant Full Length Human METTL18 Protein, GST-tagged
Cat.No. : | METTL18-6165HF |
Product Overview : | Human METTL18 full-length ORF (BAG36632.1, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 372 amino acids |
Description : | METTL18 (Methyltransferase Like 18) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity and protein methyltransferase activity. |
Molecular Mass : | 67.32 kDa |
AA Sequence : | MTFQFNFTIEDHLENELTPIRDGALTLDSSKELSVSESQKGEERDRKCSAEQFDLPQDHLWEHKSMENAAPSQDTDSPLSAASSSRNLEPHGKQPSLRAAKEHAMPKDLKKMLENKVIETLPGFQHVKLSVVKTILLKENFPGENIVSKSFSSHSDLITGVYEGGLKIWECTFDLLAYFTKAKVKFAGKKVLDLGCGSGLLGITAFKGGSKEIHFQDYNSMVIDEVTLPNVVANSTLEDEENDVNEPDVKRCRKPKVTQLYKCRFFSGEWSEFCKLVLSSEKLFVKYDLILTSETIYNPDYYSNLHQTFLRLLSKNGRVLLASKAHYFGVGGGVHLFQKFVEERDVFKTRILKIIDEGLKRFIIEITFKFPG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | METTL18 methyltransferase like 18 [ Homo sapiens ] |
Official Symbol | METTL18 |
Synonyms | HPM1; AsTP2; C1orf156; RP1-117P20.4 |
Gene ID | 92342 |
mRNA Refseq | NM_033418 |
Protein Refseq | NP_219486 |
MIM | 615255 |
UniProt ID | O95568 |
◆ Recombinant Proteins | ||
METTL18-3640H | Recombinant Human METTL18 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
METTL18-4407H | Recombinant Human METTL18 Protein, GST-tagged | +Inquiry |
METTL18-9753M | Recombinant Mouse METTL18 Protein | +Inquiry |
METTL18-2741R | Recombinant Rhesus monkey METTL18 Protein, His-tagged | +Inquiry |
Mettl18-4043M | Recombinant Mouse Mettl18 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL18-8177HCL | Recombinant Human C1orf156 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL18 Products
Required fields are marked with *
My Review for All METTL18 Products
Required fields are marked with *
0
Inquiry Basket