Recombinant Full Length Human METTL18 Protein, GST-tagged
| Cat.No. : | METTL18-6165HF |
| Product Overview : | Human METTL18 full-length ORF (BAG36632.1, 1 a.a. - 372 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 372 amino acids |
| Description : | METTL18 (Methyltransferase Like 18) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity and protein methyltransferase activity. |
| Molecular Mass : | 67.32 kDa |
| AA Sequence : | MTFQFNFTIEDHLENELTPIRDGALTLDSSKELSVSESQKGEERDRKCSAEQFDLPQDHLWEHKSMENAAPSQDTDSPLSAASSSRNLEPHGKQPSLRAAKEHAMPKDLKKMLENKVIETLPGFQHVKLSVVKTILLKENFPGENIVSKSFSSHSDLITGVYEGGLKIWECTFDLLAYFTKAKVKFAGKKVLDLGCGSGLLGITAFKGGSKEIHFQDYNSMVIDEVTLPNVVANSTLEDEENDVNEPDVKRCRKPKVTQLYKCRFFSGEWSEFCKLVLSSEKLFVKYDLILTSETIYNPDYYSNLHQTFLRLLSKNGRVLLASKAHYFGVGGGVHLFQKFVEERDVFKTRILKIIDEGLKRFIIEITFKFPG |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | METTL18 methyltransferase like 18 [ Homo sapiens ] |
| Official Symbol | METTL18 |
| Synonyms | HPM1; AsTP2; C1orf156; RP1-117P20.4 |
| Gene ID | 92342 |
| mRNA Refseq | NM_033418 |
| Protein Refseq | NP_219486 |
| MIM | 615255 |
| UniProt ID | O95568 |
| ◆ Recombinant Proteins | ||
| METTL18-7358Z | Recombinant Zebrafish METTL18 | +Inquiry |
| Mettl18-4043M | Recombinant Mouse Mettl18 Protein, Myc/DDK-tagged | +Inquiry |
| METTL18-5495M | Recombinant Mouse METTL18 Protein, His (Fc)-Avi-tagged | +Inquiry |
| METTL18-3640H | Recombinant Human METTL18 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| METTL18-4407H | Recombinant Human METTL18 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| METTL18-8177HCL | Recombinant Human C1orf156 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL18 Products
Required fields are marked with *
My Review for All METTL18 Products
Required fields are marked with *
