Recombinant Full Length Human MFAP4 Protein, GST-tagged

Cat.No. : MFAP4-6191HF
Product Overview : Human MFAP4 full-length ORF ( NP_002395.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 255 amino acids
Description : This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. [provided by RefSeq
Molecular Mass : 55 kDa
AA Sequence : MKALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFSTFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MFAP4 microfibrillar-associated protein 4 [ Homo sapiens ]
Official Symbol MFAP4
Synonyms MFAP4; microfibrillar-associated protein 4; microfibril-associated glycoprotein 4; microfibril associated glycoprotein 4;
Gene ID 4239
mRNA Refseq NM_001198695
Protein Refseq NP_001185624
MIM 600596
UniProt ID P55083

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MFAP4 Products

Required fields are marked with *

My Review for All MFAP4 Products

Required fields are marked with *

0
cart-icon
0
compare icon