Recombinant Full Length Human MFAP5 Protein, C-Flag-tagged

Cat.No. : MFAP5-853HFL
Product Overview : Recombinant Full Length Human MFAP5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 19.4 kDa
AA Sequence : MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTD DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELC
RQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Secreted Protein
Full Length : Full L.
Gene Name MFAP5 microfibril associated protein 5 [ Homo sapiens (human) ]
Official Symbol MFAP5
Synonyms AAT9; MP25; MAGP2; MAGP-2; MFAP-5
Gene ID 8076
mRNA Refseq NM_003480.4
Protein Refseq NP_003471.1
MIM 601103
UniProt ID Q13361

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MFAP5 Products

Required fields are marked with *

My Review for All MFAP5 Products

Required fields are marked with *

0
cart-icon
0
compare icon