Recombinant Full Length Human MFAP5 Protein, C-Flag-tagged
Cat.No. : | MFAP5-853HFL |
Product Overview : | Recombinant Full Length Human MFAP5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a 25-kD microfibril-associated glycoprotein which is a component of microfibrils of the extracellular matrix. The encoded protein promotes attachment of cells to microfibrils via alpha-V-beta-3 integrin. Deficiency of this gene in mice results in neutropenia. Alternate splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 19.4 kDa |
AA Sequence : | MSLLGPKVLLFLAAFIITSDWIPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTD DLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELC RQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | MFAP5 microfibril associated protein 5 [ Homo sapiens (human) ] |
Official Symbol | MFAP5 |
Synonyms | AAT9; MP25; MAGP2; MAGP-2; MFAP-5 |
Gene ID | 8076 |
mRNA Refseq | NM_003480.4 |
Protein Refseq | NP_003471.1 |
MIM | 601103 |
UniProt ID | Q13361 |
◆ Recombinant Proteins | ||
MFAP5-1927H | Recombinant Human MFAP5 protein, Fc-tagged | +Inquiry |
MFAP5-290H | Recombinant Human MFAP5 Protein, His-tagged | +Inquiry |
MFAP5-3683H | Recombinant Human MFAP5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MFAP5-4437H | Recombinant Human MFAP5 protein, His-SUMO-tagged | +Inquiry |
MFAP5-1405H | Recombinant Human MFAP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFAP5-1395HCL | Recombinant Human MFAP5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFAP5 Products
Required fields are marked with *
My Review for All MFAP5 Products
Required fields are marked with *