Recombinant Full Length Human MFNG Protein, GST-tagged

Cat.No. : MFNG-6198HF
Product Overview : Human MFNG full-length ORF ( NP_002396.2, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 321 amino acids
Description : This gene is a member of the fringe gene family which also includes Radical and Lunatic fringe. They all encode evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. While their genomic structure is distinct from other glycosyltransferases, fringe proteins have a fucose-specific beta1,3 N-acetylglucosaminyltransferase activity that leads to elongation of O-linked fucose residues on Notch, which alters Notch signaling. [provided by RefSeq
Molecular Mass : 62.6 kDa
AA Sequence : MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAVKTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASEPQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIECKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSRFRSLHCLLYPDTPWCPQLGAR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MFNG MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase [ Homo sapiens ]
Official Symbol MFNG
Synonyms MFNG; MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase; manic fringe (Drosophila) homolog , manic fringe homolog (Drosophila); beta-1,3-N-acetylglucosaminyltransferase manic fringe; O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase;
Gene ID 4242
mRNA Refseq NM_001166343
Protein Refseq NP_001159815
MIM 602577
UniProt ID O00587

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MFNG Products

Required fields are marked with *

My Review for All MFNG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon