Recombinant Full Length Human MIR137HG Protein, GST-tagged

Cat.No. : MIR137HG-5021HF
Product Overview : Human FLJ35409 full-length ORF ( NP_001001688.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 173 amino acids
Description : MIR137HG (MIR137 Host Gene) is an RNA Gene, and is affiliated with the miRNA class.
Molecular Mass : 44.8 kDa
AA Sequence : MGTGLVAVWHRPGTFLKEVGAGSDCSDVQSLWDASSALSSLPLPLGRVSNTNKRKARPPSQVSCEGVGARESLSLLLLRVFVCLFVCLFQILMDDKTTRICHLLAKRKPPPPHPSSMPGHSWGQSDVAGVGMPKMKLGRMTQSGRRGLGLQVSALASVGPHSFASFAPCLSFL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MIR137HG MIR137 host gene [ Homo sapiens (human) ]
Official Symbol MIR137HG
Synonyms MIR137HG; MIR137 host gene; MIR137 host gene (non-protein coding)
Gene ID 400765

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIR137HG Products

Required fields are marked with *

My Review for All MIR137HG Products

Required fields are marked with *

0
cart-icon