Recombinant Human MIR137HG Protein, GST-tagged

• Cat.No.: MIR137HG-4314H
• Product Overview: Human FLJ35409 full-length ORF ( NP_001001688.1, 1 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MIR137HG (MIR137 Host Gene) is an RNA Gene, and is affiliated with the miRNA class.
• Molecular Mass: 44.8 kDa
• AA Sequence: MGTGLVAVWHRPGTFLKEVGAGSDCSDVQSLWDASSALSSLPLPLGRVSNTNKRKARPPSQVSCEGVGARESLSLLLLRVFVCLFVCLFQILMDDKTTRICHLLAKRKPPPPHPSSMPGHSWGQSDVAGVGMPKMKLGRMTQSGRRGLGLQVSALASVGPHSFASFAPCLSFL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MIR137HG MIR137 host gene [ Homo sapiens (human) ]
• Official Symbol: MIR137HG
• Synonyms: MIR137HG; MIR137 host gene; MIR137 host gene (non-protein coding)
• Gene ID: 400765