Recombinant Full Length Human MIR600HG Protein, GST-tagged
| Cat.No. : | MIR600HG-3876HF |
| Product Overview : | Human C9orf45 full-length ORF ( AAH34918.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 167 amino acids |
| Description : | MIR600HG (MIR600 Host Gene) is an RNA Gene, and is affiliated with the miRNA class. |
| Molecular Mass : | 44.6 kDa |
| AA Sequence : | MVRPALHKQVLFTAHPHFLDGVLSTAFPLAHFMWQLLRDGTYHGCGRCFATTYYLSEGGGLIFRNVTGEPNCRPPTRGPRSLHLPGTKGSSGSLRSCLQPPGGRPFQHTRAYGGKMKAGPRGNSLLLSFPWADTIYFLAPSSVYPVFPKASLDSGLSSWTHLSGLLC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MIR600HG MIR600 host gene [ Homo sapiens (human) ] |
| Official Symbol | MIR600HG |
| Synonyms | C9orf45; MIR600HG; MIR600 host gene; GL012; C9orf45; NCRNA00287; |
| Gene ID | 81571 |
| ◆ Recombinant Proteins | ||
| MIR600HG-5192H | Recombinant Human MIR600HG Protein, GST-tagged | +Inquiry |
| MIR600HG-3876HF | Recombinant Full Length Human MIR600HG Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIR600HG Products
Required fields are marked with *
My Review for All MIR600HG Products
Required fields are marked with *
