Recombinant Human MIR600HG Protein, GST-tagged

• Cat.No.: MIR600HG-5192H
• Product Overview: Human C9orf45 full-length ORF ( AAH34918.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: MIR600HG (MIR600 Host Gene) is an RNA Gene, and is affiliated with the miRNA class.
• Molecular Mass: 44.6 kDa
• AA Sequence: MVRPALHKQVLFTAHPHFLDGVLSTAFPLAHFMWQLLRDGTYHGCGRCFATTYYLSEGGGLIFRNVTGEPNCRPPTRGPRSLHLPGTKGSSGSLRSCLQPPGGRPFQHTRAYGGKMKAGPRGNSLLLSFPWADTIYFLAPSSVYPVFPKASLDSGLSSWTHLSGLLC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MIR600HG MIR600 host gene [ Homo sapiens (human) ]
• Official Symbol: MIR600HG
• Synonyms: C9orf45; MIR600HG; MIR600 host gene; GL012; C9orf45; NCRNA00287
• Gene ID: 81571