Recombinant Human MIR600HG Protein, GST-tagged

Cat.No. : MIR600HG-5192H
Product Overview : Human C9orf45 full-length ORF ( AAH34918.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MIR600HG (MIR600 Host Gene) is an RNA Gene, and is affiliated with the miRNA class.
Molecular Mass : 44.6 kDa
AA Sequence : MVRPALHKQVLFTAHPHFLDGVLSTAFPLAHFMWQLLRDGTYHGCGRCFATTYYLSEGGGLIFRNVTGEPNCRPPTRGPRSLHLPGTKGSSGSLRSCLQPPGGRPFQHTRAYGGKMKAGPRGNSLLLSFPWADTIYFLAPSSVYPVFPKASLDSGLSSWTHLSGLLC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MIR600HG MIR600 host gene [ Homo sapiens (human) ]
Official Symbol MIR600HG
Synonyms C9orf45; MIR600HG; MIR600 host gene; GL012; C9orf45; NCRNA00287;
Gene ID 81571

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIR600HG Products

Required fields are marked with *

My Review for All MIR600HG Products

Required fields are marked with *

0
cart-icon