Recombinant Full Length Human Mitochondrial Carnitine/Acylcarnitine Carrier Protein(Slc25A20) Protein, His-Tagged
Cat.No. : | RFL3079HF |
Product Overview : | Recombinant Full Length Human Mitochondrial carnitine/acylcarnitine carrier protein(SLC25A20) Protein (O43772) (1-301aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-301) |
Form : | Lyophilized powder |
AA Sequence : | MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFR KTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLS GVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDV PASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTA PPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPN L |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC25A20 |
Synonyms | SLC25A20; CAC; CACTMitochondrial carnitine/acylcarnitine carrier protein; Carnitine/acylcarnitine translocase; CAC; Solute carrier family 25 member 20 |
UniProt ID | O43772 |
◆ Recombinant Proteins | ||
SLC25A20-926C | Recombinant Cynomolgus SLC25A20 Protein, His-tagged | +Inquiry |
SLC25A20-1973HFL | Recombinant Full Length Human SLC25A20 Protein, C-Flag-tagged | +Inquiry |
SLC25A20-3754H | Recombinant Human SLC25A20 protein, His-tagged | +Inquiry |
SLC25A20-669C | Recombinant Cynomolgus Monkey SLC25A20 Protein, His (Fc)-Avi-tagged | +Inquiry |
Slc25a20-1767R | Recombinant Rat Slc25a20 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A20-1777HCL | Recombinant Human SLC25A20 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A20 Products
Required fields are marked with *
My Review for All SLC25A20 Products
Required fields are marked with *