Recombinant Full Length Human Mitochondrial Fission Process Protein 1(Mtfp1) Protein, His-Tagged
| Cat.No. : | RFL152HF |
| Product Overview : | Recombinant Full Length Human Mitochondrial fission process protein 1(MTFP1) Protein (Q9UDX5) (1-166aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-166) |
| Form : | Lyophilized powder |
| AA Sequence : | MSEPQPRGAERDLYRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVASSYVLADAIDKG KKAGEVPSPEAGRSARVTVAVVDTFVWQALASVAIPGFTINRVCAASLYVLGTATRWPLA VRKWTTTALGLLTIPIIIHPIDRSVDFLLDSSLRKLYPTVGKPSSS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | MTFP1 |
| Synonyms | HSPC 242; HSPC242; Mitochondrial 18 kDa protein; Mitochondrial fission process protein 1; Mitochondrial fission protein MTP18; Mitochondrial protein 18 kDa; MTFP1; MTFP1_HUMAN; MTP 18; MTP18 |
| UniProt ID | Q9UDX5 |
| ◆ Recombinant Proteins | ||
| MTFP1-5729H | Recombinant Human MTFP1 Protein, GST-tagged | +Inquiry |
| RFL15959MF | Recombinant Full Length Mouse Mitochondrial Fission Process Protein 1(Mtfp1) Protein, His-Tagged | +Inquiry |
| MTFP1-5460H | Recombinant Human MTFP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MTFP1-4812H | Recombinant Human MTFP1 protein, GST-tagged | +Inquiry |
| MTFP1-10954Z | Recombinant Zebrafish MTFP1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MTFP1-1152HCL | Recombinant Human MTFP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTFP1 Products
Required fields are marked with *
My Review for All MTFP1 Products
Required fields are marked with *
