Recombinant Full Length Human Mitochondrial Inner Membrane Protein Oxa1L(Oxa1L) Protein, His-Tagged
Cat.No. : | RFL21698HF |
Product Overview : | Recombinant Full Length Human Mitochondrial inner membrane protein OXA1L(OXA1L) Protein (Q15070) (1-113aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-113) |
Form : | Lyophilized powder |
AA Sequence : | MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASG PRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OXA1L |
Synonyms | OXA1L; Mitochondrial inner membrane protein OXA1L; Hsa; OXA1Hs; Oxidase assembly 1-like protein; OXA1-like protein |
UniProt ID | Q15070 |
◆ Recombinant Proteins | ||
RFL17614BF | Recombinant Full Length Bovine Mitochondrial Inner Membrane Protein Oxa1L(Oxa1L) Protein, His-Tagged | +Inquiry |
OXA1L-6446M | Recombinant Mouse OXA1L Protein, His (Fc)-Avi-tagged | +Inquiry |
OXA1L-12254M | Recombinant Mouse OXA1L Protein | +Inquiry |
OXA1L-5998Z | Recombinant Zebrafish OXA1L | +Inquiry |
RFL11371MF | Recombinant Full Length Mouse Mitochondrial Inner Membrane Protein Oxa1L(Oxa1L) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OXA1L-1265HCL | Recombinant Human OXA1L cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OXA1L Products
Required fields are marked with *
My Review for All OXA1L Products
Required fields are marked with *