Recombinant Full Length Human MKI67IP Protein, GST-tagged
Cat.No. : | MKI67IP-6275HF |
Product Overview : | Human MKI67IP full-length ORF ( NP_115766.2, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 293 amino acids |
Description : | This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19.[provided by RefSeq |
Molecular Mass : | 60.7 kDa |
AA Sequence : | MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MKI67IP MKI67 (FHA domain) interacting nucleolar phosphoprotein [ Homo sapiens ] |
Official Symbol | MKI67IP |
Synonyms | MKI67IP; MKI67 (FHA domain) interacting nucleolar phosphoprotein; MKI67 FHA domain-interacting nucleolar phosphoprotein; NIFK; Nopp34; nucleolar protein interacting with the FHA domain of pKi 67; hNIFK; nucleolar phosphoprotein Nopp34; nucleolar protein interacting with the FHA domain of pKi-67; |
Gene ID | 84365 |
mRNA Refseq | NM_032390 |
Protein Refseq | NP_115766 |
MIM | 611970 |
UniProt ID | Q9BYG3 |
◆ Recombinant Proteins | ||
MKI67IP-3694R | Recombinant Rat MKI67IP Protein | +Inquiry |
MKI67IP-5361H | Recombinant Human MKI67IP Protein, GST-tagged | +Inquiry |
MKI67IP-5571M | Recombinant Mouse MKI67IP Protein, His (Fc)-Avi-tagged | +Inquiry |
MKI67IP-9860M | Recombinant Mouse MKI67IP Protein | +Inquiry |
MKI67IP-892H | Recombinant Human MKI67IP, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MKI67IP-4305HCL | Recombinant Human MKI67IP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MKI67IP Products
Required fields are marked with *
My Review for All MKI67IP Products
Required fields are marked with *