Recombinant Full Length Human MKI67IP Protein, GST-tagged
| Cat.No. : | MKI67IP-6275HF |
| Product Overview : | Human MKI67IP full-length ORF ( NP_115766.2, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 293 amino acids |
| Description : | This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19.[provided by RefSeq |
| Molecular Mass : | 60.7 kDa |
| AA Sequence : | MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MKI67IP MKI67 (FHA domain) interacting nucleolar phosphoprotein [ Homo sapiens ] |
| Official Symbol | MKI67IP |
| Synonyms | MKI67IP; MKI67 (FHA domain) interacting nucleolar phosphoprotein; MKI67 FHA domain-interacting nucleolar phosphoprotein; NIFK; Nopp34; nucleolar protein interacting with the FHA domain of pKi 67; hNIFK; nucleolar phosphoprotein Nopp34; nucleolar protein interacting with the FHA domain of pKi-67; |
| Gene ID | 84365 |
| mRNA Refseq | NM_032390 |
| Protein Refseq | NP_115766 |
| MIM | 611970 |
| UniProt ID | Q9BYG3 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MKI67IP Products
Required fields are marked with *
My Review for All MKI67IP Products
Required fields are marked with *



