Recombinant Human MKI67IP Protein, GST-tagged

Cat.No. : MKI67IP-5361H
Product Overview : Human MKI67IP full-length ORF ( NP_115766.2, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19.[provided by RefSeq
Molecular Mass : 60.7 kDa
AA Sequence : MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MKI67IP MKI67 (FHA domain) interacting nucleolar phosphoprotein [ Homo sapiens ]
Official Symbol MKI67IP
Synonyms MKI67IP; MKI67 (FHA domain) interacting nucleolar phosphoprotein; MKI67 FHA domain-interacting nucleolar phosphoprotein; NIFK; Nopp34; nucleolar protein interacting with the FHA domain of pKi 67; hNIFK; nucleolar phosphoprotein Nopp34; nucleolar protein interacting with the FHA domain of pKi-67;
Gene ID 84365
mRNA Refseq NM_032390
Protein Refseq NP_115766
MIM 611970
UniProt ID Q9BYG3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MKI67IP Products

Required fields are marked with *

My Review for All MKI67IP Products

Required fields are marked with *

0
cart-icon