Recombinant Full Length Human MKNK2 Protein, C-Flag-tagged
Cat.No. : | MKNK2-1302HFL |
Product Overview : | Recombinant Full Length Human MKNK2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the calcium/calmodulin-dependent protein kinases (CAMK) Ser/Thr protein kinase family, which belongs to the protein kinase superfamily. This protein contains conserved DLG (asp-leu-gly) and ENIL (glu-asn-ile-leu) motifs, and an N-terminal polybasic region which binds importin A and the translation factor scaffold protein eukaryotic initiation factor 4G (eIF4G). This protein is one of the downstream kinases activated by mitogen-activated protein (MAP) kinases. It phosphorylates the eukaryotic initiation factor 4E (eIF4E), thus playing important roles in the initiation of mRNA translation, oncogenic transformation and malignant cell proliferation. In addition to eIF4E, this protein also interacts with von Hippel-Lindau tumor suppressor (VHL), ring-box 1 (Rbx1) and Cullin2 (Cul2), which are all components of the CBC(VHL) ubiquitin ligase E3 complex. Multiple alternatively spliced transcript variants have been found, but the full-length nature and biological activity of only two variants are determined. These two variants encode distinct isoforms which differ in activity and regulation, and in subcellular localization. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51.7 kDa |
AA Sequence : | MVQKKPAELQGFHRSFKGQNPFELAFSLDQPDHGDSDFGLQCSARPDMPASQPIDIPDAKKRGKKKKRGR ATDSFSGRFEDVYQLQEDVLGEGAHARVQTCINLITSQEYAVKIIEKQPGHIRSRVFREVEMLYQCQGHR NVLELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQDVASALDFLHNKGIAHRDLKPEN ILCEHPNQVSPVKICDFDLGSGIKLNGDCSPISTPELLTPCGSAEYMAPEVVEAFSEEASIYDKRCDLWS LGVILYILLSGYPPFVGRCGSDCGWDRGEACPACQNMLFESIQEGKYEFPDKDWAHISCAAKDLISKLLV RDAKQRLSAAQVLQHPWVQGCAPENTLPTPMVLQRNSCAKDLTSFAAEAIAMNRQLAQHDEDLAEEEAAG QGQPVLVRATSRCLQLSPPSQSKLAQRRQRASLSSAPVVLVGDHATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Insulin signaling pathway, MAPK signaling pathway |
Full Length : | Full L. |
Gene Name | MKNK2 MAPK interacting serine/threonine kinase 2 [ Homo sapiens (human) ] |
Official Symbol | MKNK2 |
Synonyms | MNK2; GPRK7 |
Gene ID | 2872 |
mRNA Refseq | NM_199054.3 |
Protein Refseq | NP_951009.1 |
MIM | 605069 |
UniProt ID | Q9HBH9 |
◆ Recombinant Proteins | ||
MKNK2-739H | Recombinant Human MKNK2 | +Inquiry |
MKNK2-3697R | Recombinant Rat MKNK2 Protein | +Inquiry |
MKNK2-356H | Recombinant Human MKNK2, GST-tagged, Active | +Inquiry |
MKNK2-5368H | Active Recombinant Human MKNK2 Protein, GST-tagged | +Inquiry |
MKNK2-33H | Recombinant Human MKNK2 Protein (D228G, 72-385), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MKNK2-4301HCL | Recombinant Human MKNK2 293 Cell Lysate | +Inquiry |
MKNK2-4302HCL | Recombinant Human MKNK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MKNK2 Products
Required fields are marked with *
My Review for All MKNK2 Products
Required fields are marked with *
0
Inquiry Basket