Recombinant Full Length Human MKRN2 Protein, GST-tagged
| Cat.No. : | MKRN2-6345HF |
| Product Overview : | Human MKRN2 full-length ORF ( NP_054879.3, 1 a.a. - 416 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 416 amino acids |
| Description : | Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins (Gray et al., 2001 [PubMed 11597136]).[supplied by OMIM |
| Molecular Mass : | 73.3 kDa |
| AA Sequence : | MSTKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSAAAGGAVGTMAHSVPSPAFHSPHPPSEVTASIVKTNSHEPGKREKRTLVLRDRNLSGMAERKTQPSMVSNPGSCSDPQPSPEMKPHSYLDAIRSGLDDVEASSSYSNEQQLCPYAAAGECRFGDACVYLHGEVCEICRLQVLHPFDPEQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQFENPIIKSCPECRVISEFVIPSVYWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNSVRLWDFIENRESRHVPNNEDVDMTELGDLFMHLSGVESSEP |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MKRN2 makorin ring finger protein 2 [ Homo sapiens ] |
| Official Symbol | MKRN2 |
| Synonyms | MKRN2; makorin ring finger protein 2; probable E3 ubiquitin-protein ligase makorin-2; HSPC070; RNF62; RING finger protein 62; |
| Gene ID | 23609 |
| mRNA Refseq | NM_014160 |
| Protein Refseq | NP_054879 |
| MIM | 608426 |
| UniProt ID | Q9H000 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MKRN2 Products
Required fields are marked with *
My Review for All MKRN2 Products
Required fields are marked with *
